DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and nas-28

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_498342.3 Gene:nas-28 / 185658 WormBaseID:WBGene00003546 Length:497 Species:Caenorhabditis elegans


Alignment Length:327 Identity:92/327 - (28%)
Similarity:154/327 - (47%) Gaps:46/327 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLVLALALSSCQALPYVSYDDVDDTEVIELPGNGI------EEIPPTLGKDIIDLTPLGTALFGK 64
            |:...|...:.:||..:..|:..|:........||      ..:|...|:.       |.|    
 Worm     8 FIPFVLGAPTQKALEKILVDNNPDSVTNREKIRGIIDKAFENRVPRVQGRQ-------GVA---- 61

  Fly    65 PDEELTANRVG---NFSADADEMNPEELGSY-LEGDMLVPQTD-----LIMKNG--------LPT 112
            |.....|...|   |.:...:|:| :::..| .|.|:::.:..     ..::||        :..
 Worm    62 PPVTFAALNYGPKNNQTKKFEELN-QDINEYTFESDIMLNEKQAKHIATAIENGNYRSKRQAIVD 125

  Fly   113 QSSRWPNGV-VPYEIRGNFNARDMATIENAIGEYHRRTCIRFVK--RSSERDYISIRGDNSGCWS 174
            .::.|...| :.|:.....:|.::|.:..||..::..:|:.|.:  .:..|.::|..|   ||||
 Worm   126 TTNFWSVSVPIFYQFDTKLSATNIANVRKAIQFWNDNSCLSFKEDNNAKNRLFLSSAG---GCWS 187

  Fly   175 SVGR-VGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFE 238
            .||: |....::....|.| ...|||.||||||:||.|:|:|.:||.||.:.::|:..|...||:
 Worm   188 YVGKQVDMPYQMVSVGPNC-DTFGTATHELMHAIGFWHQQSRADRDNYVYVDFSNIIPSQAYNFQ 251

  Fly   239 KAA--RTEAFGVPYDYGSVMHYSKNAFSINGQP-TILAMQANGADKMGQRNGFSDYDIQKLNRMY 300
            |.|  :.:...:||||||||.|...||:::... ||||.:....:.||||...:..||..:|::|
 Worm   252 KMAVDQAQLLNLPYDYGSVMQYYPYAFAVDSSKYTILAKENGFQNSMGQREAPAFSDIIGVNKLY 316

  Fly   301 DC 302
            :|
 Worm   317 NC 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 69/194 (36%)
ZnMc_astacin_like 119..300 CDD:239807 66/187 (35%)
nas-28NP_498342.3 Astacin 135..320 CDD:279708 67/188 (36%)
ZnMc_astacin_like 135..316 CDD:239807 65/184 (35%)
CUB 393..480 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.