DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and nas-14

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_502533.2 Gene:nas-14 / 184247 WormBaseID:WBGene00003533 Length:503 Species:Caenorhabditis elegans


Alignment Length:260 Identity:99/260 - (38%)
Similarity:140/260 - (53%) Gaps:18/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TALFGKPDEELTANRVGNFSADAD-----EMNPEELGSYLEGDMLVPQTDLIMK------NGLPT 112
            ||...||.:....:...:...:.|     |:...::...|..|.|:.:.::..|      |.:..
 Worm    56 TAPVKKPTDAEIESMQNSLLFEGDIMGVPEIEKSDILKRLRDDPLLDEDEIFRKPFHSALNLVTY 120

  Fly   113 QSSRWPNGVVPYEIRGNFNARDMATIENAIGEYHRRTCIRFV-KRSSERDYISIRGDNS-GCWSS 175
            ....||.|.|||.:...........|..|..||..:||:||| |...:.|||.::.:.: ||.|.
 Worm   121 PDKLWPEGQVPYMLEEGMTNDQRTAIAQAFDEYKTKTCVRFVPKTDDDFDYIYVKRNVAFGCSSY 185

  Fly   176 VGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKA 240
            |||.||.|.|:|:...|.|: |...|||||||||.||.:|.:||.:|.|..:|::...|.||||.
 Worm   186 VGRAGGNQTVSLEVDKCFSK-GIIAHELMHALGFFHEHSRTDRDDFVDINEDNIRPGMMRNFEKY 249

  Fly   241 AR--TEAFGVPYDYGSVMHYSKNAFSINGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDCG 303
            .|  .::.|:||||.|||||.|.|||.||:|||:. :.|.|| :|||...|:.|.:|:|::|.||
 Worm   250 PRKIIDSLGMPYDYESVMHYHKLAFSRNGKPTIIP-KDNEAD-VGQRYKLSEMDSKKVNKLYQCG 312

  Fly   304  303
             Worm   313  312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 88/192 (46%)
ZnMc_astacin_like 119..300 CDD:239807 83/184 (45%)
nas-14NP_502533.2 Astacin 123..313 CDD:279708 88/193 (46%)
ZnMc_astacin_like 128..309 CDD:239807 83/183 (45%)
ShKT 380..414 CDD:214586
ShK 468..503 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm4830
orthoMCL 1 0.900 - - OOG6_101406
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.680

Return to query results.
Submit another query.