DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and nas-12

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_501871.2 Gene:nas-12 / 182848 WormBaseID:WBGene00003531 Length:384 Species:Caenorhabditis elegans


Alignment Length:228 Identity:73/228 - (32%)
Similarity:115/228 - (50%) Gaps:23/228 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GDMLVPQTDLIMK----------NGLPTQSS---RWPNGVVPYEIRGNFNARDMATIENAIGEYH 146
            ||||:....||..          .|:..:.|   ||.|.:|||.|...::......:.:::..:.
 Worm    48 GDMLLTPAQLIRYENSKDSDLSIRGVSIKGSSMNRWSNNIVPYVISPQYSPAQKQILVSSLRYFE 112

  Fly   147 RRTCIRFVKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLH 211
            |.:|.:||:|:::.||:.| ....||:|.||::||:|.::| :..|:: .....||:|||:||.|
 Worm   113 RVSCFKFVERTTQNDYLFI-VPLDGCYSYVGKIGGRQTLSL-AADCIA-DYIIWHEMMHAIGFEH 174

  Fly   212 EQNRMERDGYVAIQYNNVQSSAMNNFEKAARTEAFGVP--YDYGSVMHYSKNAFSINGQPTILAM 274
            |..|.:||.::.:.|.||....|.||:| .:|.....|  ||:.|:|||...||........:.:
 Worm   175 EHQRPDRDSFIRVDYANVIPGQMINFDK-LKTSHVEYPDIYDFKSIMHYDGYAFGRVDTARRVRL 238

  Fly   275 QANGADKMG----QRNGFSDYDIQKLNRMYDCG 303
            ......|.|    ....|:..||:||||:..||
 Worm   239 ATMTPLKPGVTLEDNMKFTATDIEKLNRLGQCG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 65/194 (34%)
ZnMc_astacin_like 119..300 CDD:239807 61/186 (33%)
nas-12NP_501871.2 Astacin 81..272 CDD:279708 65/195 (33%)
ZnMc_astacin_like 85..267 CDD:239807 60/185 (32%)
ShK 286..325 CDD:279838
ShK 347..384 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5777
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.