DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and nas-7

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_495552.2 Gene:nas-7 / 182368 WormBaseID:WBGene00003526 Length:382 Species:Caenorhabditis elegans


Alignment Length:249 Identity:93/249 - (37%)
Similarity:141/249 - (56%) Gaps:25/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ADEMNPEEL-GSYL--------EGDMLVPQTDLIMKNGLPTQSSRWPNGVVPYEIRGNFNARDMA 136
            ||::..||| |.::        :.|:.:|:..  .:||:...:..|||..:||.|..:::..:.|
 Worm    46 ADKLTREELFGKHIPVEVVNDFKSDIRLPRRH--KRNGVSRAAKLWPNARIPYAISPHYSPHERA 108

  Fly   137 TIENAIGEYHRRTCIRFVKR-SSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAM 200
            .:..|:.:||.:||||||.| :.|.||:.| |...||:|.|||..|.|.::|.: ||:.. .|.:
 Worm   109 LLAKAVKQYHEKTCIRFVPRQTGEPDYLFI-GKVDGCFSEVGRTSGVQVLSLDN-GCMEY-ATII 170

  Fly   201 HELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKA--ARTEAFGVPYDYGSVMHYSKNAF 263
            ||:||.:||.||..|.:||.::.|.:.|:...|::.|.|.  ::|..:|.||||.|::||...||
 Worm   171 HEMMHVVGFYHEHERWDRDNFIDIIWQNIDRGALDQFGKVDLSKTSYYGQPYDYKSILHYDSLAF 235

  Fly   264 SINGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDCGTVNAVPVAPGLPAP 317
            |.||.||:|....:..  :|....|||.||.|:||||:|      ||...:.||
 Worm   236 SKNGFPTMLPKVKSAT--IGNARDFSDVDISKINRMYNC------PVEKSVTAP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 79/190 (42%)
ZnMc_astacin_like 119..300 CDD:239807 74/183 (40%)
nas-7NP_495552.2 Astacin 87..274 CDD:279708 79/197 (40%)
ZnMc_astacin_like 91..270 CDD:239807 74/183 (40%)
ShK 347..382 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I2268
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm4854
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.