DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and nas-37

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001024413.1 Gene:nas-37 / 181208 WormBaseID:WBGene00003553 Length:765 Species:Caenorhabditis elegans


Alignment Length:338 Identity:104/338 - (30%)
Similarity:151/338 - (44%) Gaps:69/338 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKVFLVLALALSSCQALPYVSYDDVDD-TEVIEL-----------------PGNGIEEIPPTLGK 49
            |||.|.| :.|.|..:..|::.|.|.| .||.||                 |. .|:.|...:.|
 Worm     7 LKVCLAL-IGLVSIVSTAYIANDVVSDYAEVKELLAAFYRKHAKKYGHDYDPA-AIQAIAENMDK 69

  Fly    50 DIIDLTPLGTALFGKPDE-ELTANRVGNFSADADEMNPEELGSYLEGDML--VPQTDLIMKNGLP 111
            .:            |.|: |.|.||             :......|.|::  :||.:.::.....
 Worm    70 SV------------KNDKTEATVNR-------------KLWNEVFENDIILTLPQAESLLSESNS 109

  Fly   112 TQSSR---------WPNGVVPYEIRGNFNA-RDMATIENAIGEYHRRTCIRFVKRSSERDYIS-I 165
            .:|.|         |||..:.||..|.... |.:  |.:||....:..|.:|.:...:||.:. .
 Worm   110 PRSRRQAHPDPRNFWPNLTISYEFYGGEETWRQL--IRSAIRHVEQNVCFKFKENGGDRDGLRYY 172

  Fly   166 RGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQ 230
            ||  :||||:||||||:|.|:: ..||.|. |...||.:||||..|||:|.:||.:::|..:.:.
 Worm   173 RG--NGCWSNVGRVGGRQLVSI-GYGCDSL-GIVSHETLHALGLWHEQSRDDRDNFISIVADKIT 233

  Fly   231 SSAMNNFEK--AARTEAFGVPYDYGSVMHYSKNAFSIN-GQPTILAMQANGADKMGQRNGFSDYD 292
            .....||.|  ||.::..|.|||.||||||...:|:.: ...||........:.:|||:|.|..|
 Worm   234 RGTEGNFAKRTAANSDNLGQPYDLGSVMHYGAKSFAYDWSSDTIKTRDWRYQNTIGQRDGLSFKD 298

  Fly   293 IQKLNRMYDCGTV 305
            .:.:|..| |..|
 Worm   299 AKMINTRY-CSNV 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 73/201 (36%)
ZnMc_astacin_like 119..300 CDD:239807 68/185 (37%)
nas-37NP_001024413.1 Astacin 122..309 CDD:279708 72/193 (37%)
ZnMc_astacin_like 126..306 CDD:239807 68/185 (37%)
CUB 370..455 CDD:214483
TSP1 579..626 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.