DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and nas-38

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001359993.1 Gene:nas-38 / 180407 WormBaseID:WBGene00003554 Length:727 Species:Caenorhabditis elegans


Alignment Length:244 Identity:76/244 - (31%)
Similarity:115/244 - (47%) Gaps:19/244 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NFSADADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSR-------------W-PNGVVPYEI 126
            |.....||:.......|.:||:.:.:..:.:.....||..|             | ..|.:.::.
 Worm    70 NTGVHHDELAVNNADEYFQGDVDLSEQQVKIIEDQFTQGKREKRKIGRNPLYKKWDTRGPISFDY 134

  Fly   127 RGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPG 191
            ..:...:....|.:|:..:.:.||:||.:.....|.:.. .|..||.|.||||||.|.:::.:||
 Worm   135 AESIPFQTRQKIRSAMLLWQQHTCLRFEEGGPNVDRLEF-FDGGGCSSFVGRVGGTQGISISTPG 198

  Fly   192 CLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAA--RTEAFGVPYDYGS 254
            | ...|...||:.||||..|||.|.:::.::||.|||:..|..|||:...  ..|.:.:|||.||
 Worm   199 C-DVVGIISHEIGHALGIFHEQARPDQERHIAINYNNIPLSRWNNFQAVGENHAETYNLPYDTGS 262

  Fly   255 VMHYSKNAFSING-QPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDC 302
            ||||....|:.:. .|||..::......:|||.|.|..|.|.:|..|.|
 Worm   263 VMHYGPYGFASDPYTPTIRTLERVQQSTIGQRAGPSFLDYQAINMAYGC 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 68/204 (33%)
ZnMc_astacin_like 119..300 CDD:239807 64/183 (35%)
nas-38NP_001359993.1 Astacin 122..313 CDD:366617 67/192 (35%)
CUB 367..466 CDD:214483
TSP1 613..658 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.