DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and nas-32

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_503351.3 Gene:nas-32 / 178595 WormBaseID:WBGene00003550 Length:653 Species:Caenorhabditis elegans


Alignment Length:309 Identity:85/309 - (27%)
Similarity:122/309 - (39%) Gaps:51/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IEEIPPTLGK-DIIDLTPLGTALFGKPDEELTANRVGNFSADADEMNPEELGSYLEGDMLVPQTD 103
            |.|.||.|.. ::.:...|...|| :.|..|..|::...|::....:..:               
 Worm   153 ITENPPALDMFEVNERAGLNEYLF-QGDINLNNNQIAKISSEQSSKSRRK--------------- 201

  Fly   104 LIMKNGLPTQSSRWPNGVVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGD 168
               |..:...:..||..||.|.............:.:||......||::|...|:..:.:.| ..
 Worm   202 ---KRQIDNLAQFWPGKVVYYYFDSGLTTTVQQIVRDAITFLESNTCLKFELNSTATNRVKI-FS 262

  Fly   169 NSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSA 233
            ..||:|..|.:||:|.::| ..|| ...|||.||:.|.||..|.|.|.:||.||.|...:|..|:
 Worm   263 GVGCYSDTGMLGGEQTLSL-GYGC-EVTGTAAHEIAHTLGLFHTQMRSDRDDYVTIDLTDVPESS 325

  Fly   234 MNNFEKAARTEAFG---VPYDYGSVMHYSKNAFSINGQPTILAMQANGADKMGQRNGFSDY---- 291
            ..||.|.  |||..   |.|:|||.||||..||..:|          |.|.:..::....|    
 Worm   326 QQNFIKL--TEATSTNLVDYEYGSFMHYSGRAFVSSG----------GVDSIVPKDPVMVYTMGG 378

  Fly   292 ------DIQKLNRMYDCGTVNAVPVAPG---LPAPAPAPGAPAGSGNPI 331
                  |::.||..|.|.....:....|   .||.......|.|.|..:
 Worm   379 RIVTFLDLKMLNTHYSCSCPTILSCGNGGFTNPANCSVCICPYGFGGAL 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 66/200 (33%)
ZnMc_astacin_like 119..300 CDD:239807 62/193 (32%)
nas-32NP_503351.3 Astacin 210..397 CDD:279708 66/201 (33%)
ZnMc_astacin_like 214..393 CDD:239807 62/193 (32%)
CUB 464..>528 CDD:294042
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.