DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and dpy-31

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001022731.1 Gene:dpy-31 / 176014 WormBaseID:WBGene00006592 Length:592 Species:Caenorhabditis elegans


Alignment Length:389 Identity:106/389 - (27%)
Similarity:164/389 - (42%) Gaps:89/389 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVFLVLALALSSCQALPYVSYDDVDDTEVIELPGNGIEEIPPTLGKDIIDLTPLGTALFGKPDEE 68
            |:|::..| ||.|.|   .|..|:.:.:         ||.||:....:     ....:..:.|::
 Worm     3 KIFIIFGL-LSLCAA---HSLRDLSNKD---------EEDPPSSAPGV-----RKRRMMSEEDQK 49

  Fly    69 LTANRVGNFSADADE------------------------MNPEELGSYLEGD-MLVPQ------- 101
            .....:...:..|||                        :||||.|.:.:|| :|.|:       
 Worm    50 TVDYYMDKLNKLADEKHPEEIERHKNPELVAWDRKRDSVLNPEEQGKFFQGDIVLYPEQAKALYE 114

  Fly   102 ------TDLIMKNGLPTQSSRW-PNGVVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVK---- 155
                  ...:.:..:.:...|| .:..:.|...|:...|:...||.|:..:|..||:.|.:    
 Worm   115 QALTEGKTRVKRKFIGSNLRRWDASRPIIYAFDGSHTQREQRIIELALEHWHNITCLNFQRNDQA 179

  Fly   156 RSSERDYISIRGDNSGCWSSVGR--VGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMER 218
            .|..|...:   |..||.|:|||  :|.:|.|:| :|.|: |.|...||:.|||||.|||:|.:|
 Worm   180 NSGNRIVFT---DVDGCASNVGRHPLGEEQLVSL-APECI-RLGVIAHEVAHALGFWHEQSRPDR 239

  Fly   219 DGYVAIQYNNVQSSAMNNF--EKAARTEAFGVPYDYGSVMHYSKNAFS-INGQPTILAMQANGAD 280
            |.||.:::.|:...:...|  |.....:..||||||||:|||...||| .:...||.....:...
 Worm   240 DQYVTVRWENIDKDSKGQFLKEDPDDVDNAGVPYDYGSIMHYRSKAFSKFDDLYTISTYVTDYQK 304

  Fly   281 KMGQRNGFSDYDIQKLNRMYDCGTVNAVPVAPGLPAPAPAPGAPAGSGNP-------IVDSFIG 337
            .:|||:..|..||:.:|::| |..|          .|:..|....|..:|       ..|.|.|
 Worm   305 TIGQRDQLSFNDIRLMNKIY-CSAV----------CPSKLPCQRGGYTDPRRCDRCRCPDGFTG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 72/197 (37%)
ZnMc_astacin_like 119..300 CDD:239807 68/189 (36%)
dpy-31NP_001022731.1 Astacin 134..327 CDD:279708 72/198 (36%)
ZnMc_astacin_like 139..324 CDD:239807 68/189 (36%)
CUB 383..483 CDD:214483
TSP1 493..539 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.