DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and toh-1

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_497769.3 Gene:toh-1 / 175491 WormBaseID:WBGene00006591 Length:414 Species:Caenorhabditis elegans


Alignment Length:237 Identity:73/237 - (30%)
Similarity:113/237 - (47%) Gaps:32/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 WPNGVVPYEI-RGNFNARDMATIENAIGEYHRRTCIRFVKRSSERD---YISIRGDNSGCWSS-V 176
            |.:..:|::| .|::|.:.:  |...|..:...||:||.:....||   |:..:||:  |::. :
 Worm    71 WNSYEIPFQIWGGDYNFQSL--IRRGIRMWEDSTCLRFKENQQSRDAIRYVLEKGDS--CFTEYI 131

  Fly   177 GRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEK-A 240
            ||.||.|::.:.|. |......| ||..|||||.|...|.:||.:::|.:.||...|..:|.. .
 Worm   132 GRNGGHQDIIIGSE-CAEEYVVA-HETGHALGFWHTHQRPDRDRHISINWKNVMEEATASFMPFR 194

  Fly   241 ARTEAFG--------VPYDYGSVMHYSKNAFSIN-GQPTILAMQANGADKMG-QRNGFSDYDIQK 295
            :..:|||        |||||||:|||...|.::. ...||:..:......|| ::..|.|..:  
 Worm   195 SMLQAFGIRQVSPRRVPYDYGSLMHYHAVAHAVKVSDFTIVPKELKYVTTMGTEKMAFLDAKV-- 257

  Fly   296 LNRMYDC-----GTVNAVPVAPGLPAP--APAPGAPAGSGNP 330
            :|.:| |     |..:...:|.|.|.|  ......|.|.|.|
 Worm   258 INDIY-CPNACQGRNHLNCLAGGYPDPNNCNVCRCPEGLGGP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 64/207 (31%)
ZnMc_astacin_like 119..300 CDD:239807 61/196 (31%)
toh-1NP_497769.3 Astacin 71..265 CDD:279708 64/202 (32%)
ZnMc_astacin_like 73..262 CDD:239807 61/196 (31%)
CUB 320..410 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.