DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and Mep1a

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_032611.2 Gene:Mep1a / 17287 MGIID:96963 Length:760 Species:Mus musculus


Alignment Length:231 Identity:80/231 - (34%)
Similarity:118/231 - (51%) Gaps:21/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRW--PNGVVPYEIRGNFNARDMATIENAI 142
            |..|:|.....:..:||:|:|:|    :|.:...||||  |   :||.:..|........|.:|.
Mouse    54 DIFEINLAAGLNLFQGDILLPRT----RNAMRDPSSRWKLP---IPYILADNLELNAKGAILHAF 111

  Fly   143 GEYHRRTCIRFVKRSSERDYISIRGDNSGCWSSVG--RVGGKQEVNLQSPGCLSRPGTAMHELMH 205
            ..:..::|:.|.....|..|| |....|||||.:|  :||  |.::: ..|| ....|..||::|
Mouse   112 EMFRLKSCVDFKPYEGESSYI-IFQKLSGCWSMIGDQQVG--QNISI-GEGC-DFKATIEHEILH 171

  Fly   206 ALGFLHEQNRMERDGYVAIQYNNVQSSAMNNF---EKAARTEAFGVPYDYGSVMHYSKNAFSING 267
            ||||.|||:|.:||.||.|.::.:.:...:||   :....|: ...||||.|:|||...:|:.|.
Mouse   172 ALGFFHEQSRTDRDDYVNIWWDQIITDYEHNFNTYDDNTITD-LNTPYDYESLMHYGPFSFNKNE 235

  Fly   268 Q-PTILAMQANGADKMGQRNGFSDYDIQKLNRMYDC 302
            . |||..........:||...||..|:.:|||||:|
Mouse   236 SIPTITTKIPEFNTIIGQLPDFSAIDLIRLNRMYNC 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 69/195 (35%)
ZnMc_astacin_like 119..300 CDD:239807 63/186 (34%)
Mep1aNP_032611.2 ZnMc 46..271 CDD:381785 79/229 (34%)
MAM 281..444 CDD:366209
MATH 443..607 CDD:351761
EGF 688..722 CDD:333761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I4395
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44135
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.