DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and Bmp1

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001346950.1 Gene:Bmp1 / 12153 MGIID:88176 Length:991 Species:Mus musculus


Alignment Length:351 Identity:103/351 - (29%)
Similarity:146/351 - (41%) Gaps:87/351 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLKVFLVLALALSSCQALPYVSYDDVDDTEVIELPGNGIEEIPPTLG-KDIIDLTPLGTALF-- 62
            :||.:.|:|.|...:.:.|....|       ..:|   |.|:.|..|. ||     |...|.|  
Mouse    12 LSLPLLLLLLLLPRAGRPLDLADY-------TYDL---GEEDAPELLNYKD-----PCKAAAFLG 61

  Fly    63 --GKPDEELTANRV-------------------GNFSADADEMNPEELGSYLEGDMLVPQTDLIM 106
              ...:|:|.|.:|                   ||.||         ||.  :|....||.:...
Mouse    62 DIALDEEDLRAFQVQQAAVLRQQTARRPSIKAAGNSSA---------LGG--QGTSGQPQRESRG 115

  Fly   107 K-NGLP----TQSSR----WPNGVVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDY 162
            : .|.|    ..:||    ||:||:|:.|.|||.....|....|:..:.:.||:.|::|:.|..|
Mouse   116 RWRGRPRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSY 180

  Fly   163 ISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYN 227
            |.......||.|.|||.||..:.......| .:.|..:|||.|.:||.||..|.:||.:|:|...
Mouse   181 IVFTYRPCGCCSYVGRRGGGPQAISIGKNC-DKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRE 244

  Fly   228 NVQSSAMNNFEK--AARTEAFGVPYDYGSVMHYSKNAFS-------------ING-QPTILAMQA 276
            |:|.....||.|  ....|:.|..||:.|:|||::|.||             :|| :|:|     
Mouse   245 NIQPGQEYNFLKMEVQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPSI----- 304

  Fly   277 NGADKMGQRNGFSDYDIQKLNRMYDC 302
                  |||...|..||.:..::|.|
Mouse   305 ------GQRTRLSKGDIAQARKLYKC 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 70/207 (34%)
ZnMc_astacin_like 119..300 CDD:239807 65/196 (33%)
Bmp1NP_001346950.1 ZnMc_BMP1_TLD 126..325 CDD:239808 71/211 (34%)
CUB 327..436 CDD:278839
CUB 440..549 CDD:278839
FXa_inhibition 560..592 CDD:317114
CUB 596..705 CDD:278839
FXa_inhibition 712..747 CDD:317114
CUB 752..861 CDD:278839
CUB 865..978 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.