DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and astl2d.2

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_031756346.1 Gene:astl2d.2 / 105947175 XenbaseID:XB-GENE-22069740 Length:517 Species:Xenopus tropicalis


Alignment Length:216 Identity:85/216 - (39%)
Similarity:123/216 - (56%) Gaps:15/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LEGDMLVPQTDLIMKNGLPTQSSRW--PNGV--VPYEIRGNFNARDMATIENAIGEYHRRTCIRF 153
            ::||:.|    .:.::.:......|  .||:  |||.:...:::..:.||.:|:..|...||::|
 Frog    79 VQGDIAV----RVSRSTIVCTDCFWQKSNGIVYVPYTLDKQYSSDQINTITSAMEVYSTLTCVQF 139

  Fly   154 VKRSSERDYISI-RGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRME 217
            |..:.|.|||:| .||  ||||.:||.||.|.|:::...|.|. ||.||||.|||||:|||:|.:
 Frog   140 VPYTDEEDYIAITSGD--GCWSYMGRQGGAQVVSVEKGYCTSE-GTTMHELNHALGFVHEQSRSD 201

  Fly   218 RDGYVAIQYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKNAFS-INGQPTILAMQANGADK 281
            ||.||.|.|..:....:.||:| ..|......|||.|:|||...||| ..||.||:| :.|....
 Frog   202 RDNYVDIMYQYISPGDIVNFKK-METNNLNTTYDYHSIMHYPAWAFSNTTGQNTIVA-KLNPNTP 264

  Fly   282 MGQRNGFSDYDIQKLNRMYDC 302
            :|..:..::.||.|:||:|.|
 Frog   265 LGPGSTMTNLDITKINRLYQC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 82/193 (42%)
ZnMc_astacin_like 119..300 CDD:239807 79/184 (43%)
astl2d.2XP_031756346.1 ZnMc 103..285 CDD:412141 80/186 (43%)
CUB 288..399 CDD:238001
CUB 402..513 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.