DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and astl2d.4

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_004913426.2 Gene:astl2d.4 / 101734297 XenbaseID:XB-GENE-22069748 Length:537 Species:Xenopus tropicalis


Alignment Length:330 Identity:113/330 - (34%)
Similarity:160/330 - (48%) Gaps:52/330 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSSCQALPYVS--YDDVDDTEVIELPGNGIEEIPPTLGKDII--DLTPLGT---ALFGKPDEELT 70
            |.||..:..:|  :.|.|.:.    ..||...|   .|.|.:  .||...|   |:|| ||:   
 Frog    29 LFSCLLIQALSAPHQDTDSSH----NNNGQNGI---FGLDDVFSRLTESNTGQNAIFG-PDD--- 82

  Fly    71 ANRVGNFSADADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRWP--NGV--VPYEIRGNFN 131
                 .||. ..|.|.......::||:.:.    :.::.|...:..||  ||.  |||.:...::
 Frog    83 -----GFSR-LTEANKGSRVRRVQGDIAIG----VSRSALNCTNCLWPKTNGTVYVPYTLDDEYS 137

  Fly   132 ARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRP 196
            ..::.||..|:..|...||::||..:.|.||::|:..| ||||.:||.||.|.|:::...|.|. 
 Frog   138 NNEVNTITAAMQVYATLTCVQFVPYTDEDDYVAIKSAN-GCWSYMGRQGGAQVVSVEKGYCTSE- 200

  Fly   197 GTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKN 261
            ||.||||.|||||:|||:|.:||.||.|.|..:....:.||| ...|......|||.|:|||...
 Frog   201 GTTMHELNHALGFVHEQSRSDRDNYVNIMYQYISPGDIVNFE-IMNTNNLNTIYDYRSIMHYPAW 264

  Fly   262 AFS-INGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDC-----------GTVNAVPVAPGL 314
            ||| ..||.||:| :.|....:|..:..:..||.|:||:|:|           |||.:.    ..
 Frog   265 AFSNTTGQNTIVA-KPNPNIIIGAGSTMTSLDIIKINRLYECDVCSSLLTDAKGTVTSA----NY 324

  Fly   315 PAPAP 319
            |:|.|
 Frog   325 PSPYP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 81/203 (40%)
ZnMc_astacin_like 119..300 CDD:239807 77/183 (42%)
astl2d.4XP_004913426.2 ZnMc_hatching_enzyme 123..305 CDD:239810 78/185 (42%)
CUB 308..417 CDD:395345 6/26 (23%)
CUB 422..533 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.