DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and LOC100496745

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_017948777.1 Gene:LOC100496745 / 100496745 -ID:- Length:432 Species:Xenopus tropicalis


Alignment Length:326 Identity:113/326 - (34%)
Similarity:155/326 - (47%) Gaps:87/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LEGDMLVPQTDLIMKNGL--PTQSSRWPNG-----VVPYEIRGNFNARDMATIENAIGEYHRRTC 150
            ::||:.|.::    :|.|  |.:|..||..     :|||.:..|:|:.:...|..|:.|....||
 Frog     2 IQGDIAVKKS----RNALMCPGKSCLWPRSRKGLVLVPYTLSNNYNSTERDIIRAAMDEVTVLTC 62

  Fly   151 IRFVKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNR 215
            |:||..::|.||:.|| ...||||.:|||||.|:|:|...|||.. |...|||:|:|||.|||.|
 Frog    63 IQFVTYNNESDYLRIR-PYDGCWSYIGRVGGAQDVSLMKTGCLHH-GVIQHELLHSLGFQHEQCR 125

  Fly   216 MERDGYVAIQYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKNAFSIN-GQPTILAMQANGA 279
            .:||.|:.|.::|:......||.| ..|:..|.||||.|||||.|.||:.| |:|| |..:.|.:
 Frog   126 SDRDNYININWDNISHDKERNFLK-MNTQNLGSPYDYLSVMHYGKFAFATNSGKPT-LEPKGNPS 188

  Fly   280 DKMGQRNGFSDYDIQKLNRMYDCGT-------------------------VNAVPVAPG------ 313
            ..:|||.|.|..|::|:||:|.|..                         |..:.|..|      
 Frog   189 AMIGQRVGLSSLDVEKINRLYQCSVCGFLLADRWGDFSWNSRLYPNTSVCVWLIRVPQGKVFLQF 253

  Fly   314 -----LPAPAPAPGA-----------------------PAGSGNPIVDSFIGGLI------SGLG 344
                 .|:||.|.|:                       |||    :|.|  |.||      ||||
 Frog   254 HSLGIRPSPACAQGSVTVYDGQSKESPLLISKTCGKARPAG----VVAS--GNLIRMDVATSGLG 312

  Fly   345 L 345
            :
 Frog   313 V 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 86/193 (45%)
ZnMc_astacin_like 119..300 CDD:239807 82/186 (44%)
LOC100496745XP_017948777.1 ZnMc 30..211 CDD:412141 83/184 (45%)
CUB 232..321 CDD:238001 20/88 (23%)
CUB 324..428 CDD:395345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.