Sequence 1: | NP_001262871.1 | Gene: | CG6763 / 42754 | FlyBaseID: | FBgn0039069 | Length: | 354 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017948777.1 | Gene: | LOC100496745 / 100496745 | -ID: | - | Length: | 432 | Species: | Xenopus tropicalis |
Alignment Length: | 326 | Identity: | 113/326 - (34%) |
---|---|---|---|
Similarity: | 155/326 - (47%) | Gaps: | 87/326 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 LEGDMLVPQTDLIMKNGL--PTQSSRWPNG-----VVPYEIRGNFNARDMATIENAIGEYHRRTC 150
Fly 151 IRFVKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNR 215
Fly 216 MERDGYVAIQYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKNAFSIN-GQPTILAMQANGA 279
Fly 280 DKMGQRNGFSDYDIQKLNRMYDCGT-------------------------VNAVPVAPG------ 313
Fly 314 -----LPAPAPAPGA-----------------------PAGSGNPIVDSFIGGLI------SGLG 344
Fly 345 L 345 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6763 | NP_001262871.1 | Astacin | 116..304 | CDD:279708 | 86/193 (45%) |
ZnMc_astacin_like | 119..300 | CDD:239807 | 82/186 (44%) | ||
LOC100496745 | XP_017948777.1 | ZnMc | 30..211 | CDD:412141 | 83/184 (45%) |
CUB | 232..321 | CDD:238001 | 20/88 (23%) | ||
CUB | 324..428 | CDD:395345 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D472790at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |