DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and XB5917669

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_031756322.1 Gene:XB5917669 / 100496293 XenbaseID:XB-GENE-5917670 Length:578 Species:Xenopus tropicalis


Alignment Length:284 Identity:97/284 - (34%)
Similarity:136/284 - (47%) Gaps:50/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 FSADADEMNPEELGSYLEGDM-LVPQTDL---IMK----NGLPTQSSRWPNGV------------ 121
            :|...|....|...|:|||.. ...|.|:   |:|    ||:|........||            
 Frog    96 YSLGYDHQKRELCVSFLEGKSDPFGQGDVFSRILKANQGNGVPRVQEDIAVGVSRSAITSTECLW 160

  Fly   122 --------VPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISI-RGDNSGCWSSVG 177
                    |||.:...::..::.|:.:|:..|...||::||..:.|.||::| .||  ||||.:|
 Frog   161 QKTNETVYVPYTLDSKYSNSEVNTMTSAMEVYATLTCVQFVPYTDEDDYVNITSGD--GCWSYMG 223

  Fly   178 RVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAAR 242
            |.||.|.|:::...|.|. ||.||||.|||||:||.:|.:||.||.|.|..:....:.||| ...
 Frog   224 RQGGAQVVSVEKGYCTSE-GTTMHELNHALGFVHEHSRSDRDNYVNIMYQYISPGDIVNFE-IMN 286

  Fly   243 TEAFGVPYDYGSVMHYSKNAFS-INGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDC---- 302
            |......|||.|:|||...||| ..|:.||:| :.|....:|..:..:..||.|:||:|:|    
 Frog   287 TNNLNTIYDYRSIMHYPAWAFSNTTGKNTIVA-KLNPNIIIGAGSTMTSLDIIKINRLYECDVCS 350

  Fly   303 -------GTVNAVPVAPGLPAPAP 319
                   |||.:.    ..|:|.|
 Frog   351 SLLTDAKGTVTSA----NYPSPYP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 77/220 (35%)
ZnMc_astacin_like 119..300 CDD:239807 75/202 (37%)
XB5917669XP_031756322.1 C2 92..>113 CDD:417471 4/16 (25%)
ZnMc 164..346 CDD:412141 74/186 (40%)
CUB 349..458 CDD:395345 6/26 (23%)
CUB 463..574 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.