DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and syt13

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_002937348.3 Gene:syt13 / 100496122 XenbaseID:XB-GENE-955112 Length:508 Species:Xenopus tropicalis


Alignment Length:271 Identity:109/271 - (40%)
Similarity:157/271 - (57%) Gaps:26/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PTLGKDIIDLTPLGTALFGKPDEELTANRVGNFSADADEMNPEELGSYLEGDMLVPQTDLIMKNG 109
            |:.|:.|:...|.|.     |.|::    :|:.    ::||.........|||.:|.....::  
 Frog    31 PSGGETIVRDQPEGL-----PIEDI----IGSI----EKMNKGRTRLLQHGDMAIPTGRSAIR-- 80

  Fly   110 LPTQSSRWP---NGV--VPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGDN 169
            ..::...||   ||:  |||.:...:|.:|.|||..|:.|:...||||||..::|||:::|..| 
 Frog    81 CTSKDCYWPKSANGLVNVPYTLAAEYNVQDRATIAAAMLEFSTLTCIRFVPHTNERDFLNIISD- 144

  Fly   170 SGCWSSVGRV-GGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSA 233
            |||||.:||. ||.|:::||..||||. |...|||.|||||:||..|.:||.||.|.:||:|...
 Frog   145 SGCWSFLGRAGGGGQDLSLQRGGCLSN-GIIQHELNHALGFVHEHTRSDRDSYVKIFWNNIQPEY 208

  Fly   234 MNNFEKAARTEAFGVPYDYGSVMHYSKNAFSINGQ-PTILAMQANGADKMGQRNGFSDYDIQKLN 297
            .::|.| ..|:..|:.|||||||||.:|::||:.| |||..: .||...:|||.|.|..|..|:|
 Frog   209 KDSFNK-TDTDNQGMEYDYGSVMHYGRNSYSIDYQLPTIQPI-PNGLIPIGQRYGLSSLDAAKIN 271

  Fly   298 RMYDCGTVNAV 308
            |:|:|...::|
 Frog   272 RLYNCSICSSV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 94/194 (48%)
ZnMc_astacin_like 119..300 CDD:239807 90/184 (49%)
syt13XP_002937348.3 ZnMc_hatching_enzyme 93..276 CDD:239810 91/186 (49%)
CUB 294..388 CDD:238001
CUB 391..504 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.