DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and astl2d.1

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_004913424.2 Gene:astl2d.1 / 100495740 XenbaseID:XB-GENE-22069737 Length:604 Species:Xenopus tropicalis


Alignment Length:331 Identity:106/331 - (32%)
Similarity:162/331 - (48%) Gaps:50/331 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VSYDDVDDTEVIELPGNGIEEIPPTLGKD---IIDLTPLGTALFGKPDEE------LTANRVGNF 77
            |:.|..||..:| :..:.::.:.|..|.|   |::...:.|.   .||..      :.|::|...
 Frog    84 VTPDSGDDFSMI-MNADKVQPVTPDSGDDFSMIMNADKVQTV---TPDSSDDFSTIMNADKVQTV 144

  Fly    78 SADADE-----MNPEELGSY--LEGDMLVPQTDLIMKNGLPTQSSRWP--NGV--VPYEIRGNFN 131
            :.|.::     ||.::....  :.||:.:.    :.::.|......|.  ||.  |||.:...::
 Frog   145 TPDHNDVFSMIMNADKASRVRRVHGDIAIG----VSRSALNCTDCLWQKINGTVYVPYTLDEQYS 205

  Fly   132 ARDMATIENAIGEYHRRTCIRFVKRSSERDYISI-RGDNSGCWSSVGRVGGKQEVNLQSPGCLSR 195
            ..::.||..|:..|...||::||..:.|.|||:| .||  ||||.:||.||.|.|::|...|.|.
 Frog   206 NNEVNTIMTAMQVYATLTCVQFVPYTDEDDYIAITSGD--GCWSYMGRQGGAQVVSVQKTYCTSE 268

  Fly   196 PGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSK 260
             ||.||||.|||||:||.:|.:||.||.|.|..:....:.|||| ..|......|||.|:|||:.
 Frog   269 -GTTMHELNHALGFVHEHSRSDRDNYVDIMYQYISPGDVANFEK-MNTNNLNTAYDYHSIMHYAA 331

  Fly   261 NAFS-INGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDC-----------GTVNAVPVAPG 313
            .:|| ..||.||:| :.:....:|..:..:..||.|:||:|.|           ||:.:.    .
 Frog   332 YSFSNTTGQNTIVA-KPDPNTPLGPGSTMTSLDITKINRLYQCDVCSYFLTDATGTITSA----N 391

  Fly   314 LPAPAP 319
            .|:|.|
 Frog   392 YPSPYP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 81/204 (40%)
ZnMc_astacin_like 119..300 CDD:239807 78/184 (42%)
astl2d.1XP_004913424.2 ZnMc_hatching_enzyme 191..373 CDD:239810 79/186 (42%)
CUB 376..485 CDD:395345 5/26 (19%)
CUB 490..601 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.