DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and astl2d.5

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_031756347.1 Gene:astl2d.5 / 100495579 XenbaseID:XB-GENE-22069752 Length:497 Species:Xenopus tropicalis


Alignment Length:239 Identity:88/239 - (36%)
Similarity:126/239 - (52%) Gaps:23/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VP--QTDL---IMKNGLPTQSSRW--PNGV--VPYEIRGNFNARDMATIENAIGEYHRRTCIRFV 154
            ||  |.|:   :.::.:......|  .||.  |||.:...::..::.|:.:|:..|...||::||
 Frog    56 VPRVQEDIAVGVSRSAITYTECLWQKTNGTVYVPYTLDDKYSNSEVNTMTSAMEVYATLTCVQFV 120

  Fly   155 KRSSERDYISI-RGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMER 218
            ..:.|.||::| .||  ||||.:||..|.|.|:::...|.|. ||.||||.|||||:|||:|.:|
 Frog   121 PYTDEDDYVNITSGD--GCWSYMGRQRGAQVVSVEKGYCTSE-GTTMHELNHALGFVHEQSRSDR 182

  Fly   219 DGYVAIQYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKNAFS-INGQPTILAMQANGADKM 282
            |.||.|.|..:....:..|:| ..:...|..|||.|||||...||| ..||.||:| :.|....:
 Frog   183 DNYVNIMYQYISPGDVAEFKK-MESNNLGTTYDYRSVMHYPAWAFSNTTGQNTIVA-KPNPNIII 245

  Fly   283 GQRNGFSDYDIQKLNRMYDCGT-------VNAVPVAPGLPAPAP 319
            |..|..:..||.|:||:|:|..       .|....:...|:|.|
 Frog   246 GAGNTMTSLDIIKINRLYECDVCSSLLTDANGTVTSANYPSPYP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 80/193 (41%)
ZnMc_astacin_like 119..300 CDD:239807 77/184 (42%)
astl2d.5XP_031756347.1 ZnMc 83..265 CDD:412141 78/186 (42%)
CUB 268..377 CDD:395345 4/22 (18%)
CUB 382..493 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.