DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and astl2f

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_002934133.3 Gene:astl2f / 100495416 XenbaseID:XB-GENE-22069764 Length:624 Species:Xenopus tropicalis


Alignment Length:308 Identity:107/308 - (34%)
Similarity:152/308 - (49%) Gaps:27/308 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NGIEEIPPTLGKDIID--LTPLGTALFGKPDEELTANRVGNFSADADEMNPEELGSYLEG--DML 98
            :|:..:|.|:...:|:  |..:...|.....:|  ..:..|.||..|     .|...||.  |..
 Frog   122 SGLVNVPYTMQYIVIETYLQEMKRTLMSLSLQE--GQKEDNSSASLD-----TLSQILEANKDTN 179

  Fly    99 VP--QTDLIMKNGLPT---QSSRWPNGV-----VPYEIRGNFNARDMATIENAIGEYHRRTCIRF 153
            ||  |.|::.|.|..|   .|..||...     |||.|...|:..:...|:.|:.|....:||||
 Frog   180 VPLVQGDILEKLGRSTTNCTSCLWPRATSGLVNVPYTIASVFDDSEQELIQGALNELMTLSCIRF 244

  Fly   154 VKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMER 218
            ..|:.|.|::|.:..| |||||||:.||.|||::...||:|. |...||.:|||||:||..|.:|
 Frog   245 KARTIETDFLSFQSGN-GCWSSVGKTGGSQEVSVSKSGCMSH-GIIQHETLHALGFIHEHCRSDR 307

  Fly   219 DGYVAIQYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKNAF-SINGQPTILAMQANGADKM 282
            |.||.|.|..:.....::|.| ..:...|:.|||.|||||.:..| :..||.||:. :.:.:..:
 Frog   308 DNYVDIIYKYISEGDRSSFTK-VNSNNLGLQYDYSSVMHYGRFTFTNTPGQATIIP-KPDLSVPI 370

  Fly   283 GQRNGFSDYDIQKLNRMYDCGTV-NAVPVAPGLPAPAPAPGAPAGSGN 329
            |||.|.|..|:.|||::|:|... |.:....|....|..|.|...:.|
 Frog   371 GQRYGVSSLDVAKLNKLYNCNICSNLLSDTSGTFTSANYPSAYPPNSN 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 78/193 (40%)
ZnMc_astacin_like 119..300 CDD:239807 74/186 (40%)
astl2fXP_002934133.3 ZnMc 209..390 CDD:412141 75/184 (41%)
CUB 394..504 CDD:238001 6/25 (24%)
CUB 507..621 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 1 1.100 - - LDO PTHR10127
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.