DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and astl2a

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_002934118.2 Gene:astl2a / 100492493 XenbaseID:XB-GENE-5966804 Length:492 Species:Xenopus tropicalis


Alignment Length:289 Identity:103/289 - (35%)
Similarity:154/289 - (53%) Gaps:41/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LGTALFGKPDEELTANRVGNFSADADEMNPEEL------------GSYLEG--DMLVPQTDLIMK 107
            ||.|| ..|.:.|:     |.:.:|..||..::            |.:.:|  |:.|.::|...|
 Frog    14 LGLAL-PSPTQILS-----NSTINATNMNGNDIFSQILRTNQGHGGLHYQGDIDVRVERSDGTCK 72

  Fly   108 NGLPTQSSRWP---NG--VVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRG 167
            :.|      ||   ||  :|||.|..::...|:.:|.:|:.|:...||:|||.||:|||::.||.
 Frog    73 DCL------WPKSQNGSVLVPYRISADYGVSDIESITDAMLEFSTLTCVRFVPRSAERDHVIIRS 131

  Fly   168 DNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSS 232
            :| ||:||.||:||.|.|:|..|.|:.. |...|||.|.||..||.:||:||.|:.:...|:.:.
 Frog   132 EN-GCFSSKGRLGGAQTVSLLKPDCVEF-GIIQHELNHVLGLAHENSRMDRDEYITVIETNIPAE 194

  Fly   233 AMNNFEKAARTEAFGVPYDYGSVMHYSKNAFSINGQPTILAMQANGADKMGQRNGFSDYDIQKLN 297
            ...:||| ..::..|:.|||.|||||...|||..|..:.|..:.|...::||..|.|:.|:.|:|
 Frog   195 FHRDFEK-PESDIVGMEYDYNSVMHYGSGAFSNTGGMSTLVPKRNPNAQLGQLYGLSNLDVSKIN 258

  Fly   298 RMYDCGTVNAVPVAP-------GLPAPAP 319
            |:|:|...:.:..||       ..|:|.|
 Frog   259 RLYECDACSTLLSAPSGTLYSANYPSPYP 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 81/192 (42%)
ZnMc_astacin_like 119..300 CDD:239807 77/182 (42%)
astl2aXP_002934118.2 ZnMc 81..263 CDD:412141 78/184 (42%)
CUB 267..377 CDD:238001 5/21 (24%)
CUB 380..491 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3822
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.