DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and astl2g

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_002934115.1 Gene:astl2g / 100491886 XenbaseID:XB-GENE-22069768 Length:505 Species:Xenopus tropicalis


Alignment Length:281 Identity:102/281 - (36%)
Similarity:154/281 - (54%) Gaps:28/281 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DIID----LTPLGTALFGKPDEELTANRVGNFSADADEMNPEE------LGSYLEG-DMLVPQTD 103
            ||:.    :..|...:.|.| .|:........:...:|..||.      :....:| ..|:.::|
 Frog     2 DIVTSCLIVASLMQCILGAP-LEIYFEEANKIAVSQEEAKPEPKDVFTIISETNKGVKKLLHESD 65

  Fly   104 LIM---KNGLPT--QSSRW--PNGV--VPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSE 159
            :::   :|.:..  .:.||  .:|:  |||.|..||:|.:::.|.:|:.::...||:.||.|:.|
 Frog    66 IVVSVDRNAMKCDGDTCRWKTSDGIVRVPYTISANFSATEVSVIVDAMQDFATLTCVNFVPRTVE 130

  Fly   160 RDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAI 224
            .||:.|..| |||||.||:.||.|||:|...||:.: ||..|||.|||||.|||:|.:||.||.|
 Frog   131 PDYLQIIPD-SGCWSYVGKTGGAQEVSLNQGGCVGK-GTVQHELNHALGFYHEQSRSDRDNYVNI 193

  Fly   225 QYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKNAFSINGQPTI--LAMQANGADKMGQRNG 287
            ...|:..:::.||:| ..|...|..|||.|||||.:|||:  .||.:  :..:.|....:|||.|
 Frog   194 LTGNIIPASIGNFDK-YNTNNLGQEYDYSSVMHYGRNAFA--KQPGLDTIVPKPNPNVPIGQRYG 255

  Fly   288 FSDYDIQKLNRMYDCGTVNAV 308
            .|:.||.|:|::|.||..:.|
 Frog   256 LSNLDISKINQLYQCGACSTV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 87/193 (45%)
ZnMc_astacin_like 119..300 CDD:239807 83/184 (45%)
astl2gXP_002934115.1 Astacin 83..272 CDD:279708 87/193 (45%)
ZnMc_hatching_enzyme 88..270 CDD:239810 84/186 (45%)
CUB 270..384 CDD:238001 3/7 (43%)
CUB 387..497 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.