DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and astl3a.1

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_002944440.3 Gene:astl3a.1 / 100491875 XenbaseID:XB-GENE-22069668 Length:514 Species:Xenopus tropicalis


Alignment Length:293 Identity:104/293 - (35%)
Similarity:147/293 - (50%) Gaps:41/293 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LFGKPDEELTANRVGNFSADADEM---NPEELGS--------------YLEGDMLVP--QTDLIM 106
            :|...||.|..|   |..|:.|.:   ..|:.|:              ....|:.:|  :.|:|.
 Frog    24 VFYSEDERLAEN---NAVANKDTLKAQGKEDTGTAKTQDSMDIHSMILAANKDIRLPTREGDIIQ 85

  Fly   107 ---KNGLPTQSSRWPNGV-----VPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYI 163
               :|.:...|..||...     |||....::||..:|..:.|:.|:...||:||...::|.|::
 Frog    86 NPGRNAINCTSCLWPKSADGTVPVPYNFSYSYNADQLALFKTAMQEFETLTCVRFRPWTTESDFL 150

  Fly   164 SIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNN 228
            :| ..|.||.||:|:.||.|.|.|.:.||:|. |...|||.|||||.|||||.:||.||.|...|
 Frog   151 NI-VSNGGCASSIGKSGGAQRVALDANGCMSM-GIIEHELNHALGFYHEQNRSDRDDYVIIHPEN 213

  Fly   229 VQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKNAFSINGQPTILAMQANGADKMGQRNGFSDYDI 293
            :...::|||.| ..|...|..|||.|||||:::|||.||:.|| ..:.|....:|||||.|..||
 Frog   214 ILPDSLNNFNK-YDTNNLGTEYDYNSVMHYARDAFSKNGKATI-EPKPNPNVPIGQRNGLSVLDI 276

  Fly   294 QKLNRMYDCGTV-------NAVPVAPGLPAPAP 319
            .|:|::|.|...       |...::...|:..|
 Frog   277 SKINKLYGCNVCSNLLSNPNGTMISANYPSAYP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 85/192 (44%)
ZnMc_astacin_like 119..300 CDD:239807 81/185 (44%)
astl3a.1XP_002944440.3 ZnMc_hatching_enzyme 104..285 CDD:239810 82/184 (45%)
CUB 289..397 CDD:238001 3/21 (14%)
CUB 402..512 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.