DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and astl3b.4

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_031746772.1 Gene:astl3b.4 / 100491283 XenbaseID:XB-GENE-22069691 Length:533 Species:Xenopus tropicalis


Alignment Length:238 Identity:92/238 - (38%)
Similarity:130/238 - (54%) Gaps:20/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EGDMLVPQTDLIMKNGLPTQSSRWPNG-----VVPYEIRGNFNARDMATIENAIGEYHRRTCIRF 153
            |||:|.|:.    ::.:......||..     :|||....|::|..:|..::|:.||...||:||
 Frog    95 EGDILRPEG----RSAMNCTECLWPKSTDGTVIVPYNFSSNYSADQLALFKSAMQEYESLTCVRF 155

  Fly   154 VKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMER 218
            |.|::|..:::|. ..|||.|.:|::||.|.|.|.|.||:.| |...|||.|||||.|||:|.:|
 Frog   156 VPRANETAFLNII-SGSGCVSFLGKLGGAQTVQLASYGCIYR-GIIQHELNHALGFYHEQSRSDR 218

  Fly   219 DGYVAIQYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKNAFSINGQPTILAMQANGADKMG 283
            |.||.|...|:......||.| |.|...|:.|||.|||||..:|||.||..||:. :.:....:|
 Frog   219 DDYVTIHTENILPGYEGNFNK-ANTNNLGLEYDYSSVMHYPGDAFSKNGNLTIVP-KPDPTVPIG 281

  Fly   284 QRNGFSDYDIQKLNRMYDC-------GTVNAVPVAPGLPAPAP 319
            ||:|.|..|:.|:||:|.|       ...|...::...|:..|
 Frog   282 QRDGLSILDVSKINRLYQCDVCSNLLSNTNGTMISANYPSAYP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 84/199 (42%)
ZnMc_astacin_like 119..300 CDD:239807 80/185 (43%)
astl3b.4XP_031746772.1 ZnMc_hatching_enzyme 119..300 CDD:239810 81/184 (44%)
CUB 304..412 CDD:238001 3/21 (14%)
CUB 417..525 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.