DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and astl3b.2

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_031746779.1 Gene:astl3b.2 / 100491112 XenbaseID:XB-GENE-22069683 Length:529 Species:Xenopus tropicalis


Alignment Length:343 Identity:112/343 - (32%)
Similarity:165/343 - (48%) Gaps:50/343 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVFLVLALALSSCQALP---------YVSYDDVDDTEVIELPGNGIEEIPPTLGKDIIDLTPLGT 59
            |..::||..:.|....|         .:..|.:.:.:::|..|...|       ||.  |...||
 Frog     7 KSIILLACIMGSAWTYPAQIIFPYQEMLEKDSLTNLDLLEALGKSAE-------KDA--LATEGT 62

  Fly    60 A------LFGKPDEELTANRVGNFSADADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRWP 118
            .      :.||     .:..|..|:..:.......:.:| :||:|.|:.    ::.:......||
 Frog    63 VRGMEMPVLGK-----KSGSVDVFTQISKVNRGIRVPTY-QGDILRPKG----RSAMNCTECLWP 117

  Fly   119 NG-----VVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGDNSGCWSSVGR 178
            ..     :|||....|::|..:|..::.:.||...||:|||.|::|.|::||..|| ||.|.:|:
 Frog   118 KSTDGTVIVPYNFSSNYSADQLALFKSTMQEYESLTCVRFVPRANETDFLSIVSDN-GCASFLGK 181

  Fly   179 VGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAART 243
            |||.|.|.|.|.||:.| |...|||.|||||.|||:|.:||.||.|...|:......||.| |.:
 Frog   182 VGGDQTVQLDSYGCIYR-GIIQHELNHALGFYHEQSRSDRDDYVTIHTENIIPGYEGNFNK-ADS 244

  Fly   244 EAFGVPYDYGSVMHYSKNAFSINGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDC------ 302
            ...|:.|||.|||||..:|||.||..||:. :.:....:|||:|.|..|:.|:||:|.|      
 Frog   245 NNLGLEYDYSSVMHYPGDAFSKNGNLTIVP-KPDPTVPIGQRDGLSILDVSKINRLYQCDVCSNL 308

  Fly   303 -GTVNAVPVAPGLPAPAP 319
             ...|...::...|:..|
 Frog   309 LSNTNGTMISANYPSAYP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 86/199 (43%)
ZnMc_astacin_like 119..300 CDD:239807 82/185 (44%)
astl3b.2XP_031746779.1 ZnMc_hatching_enzyme 121..302 CDD:239810 83/184 (45%)
CUB 306..414 CDD:238001 3/21 (14%)
CUB 419..527 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.