DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and mep1b

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001096352.1 Gene:mep1b / 100124942 XenbaseID:XB-GENE-1001365 Length:722 Species:Xenopus tropicalis


Alignment Length:248 Identity:94/248 - (37%)
Similarity:134/248 - (54%) Gaps:10/248 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LFGKPDEELTANRV-GNFSADADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRWPNGVVPY 124
            :.|.|.::.|...| |....|..::|........|||:::..|:  .:|.:.....|||. .|||
 Frog    16 VIGVPLQDNTEIDVDGGKKLDIFDINEGAGLDLFEGDIILADTN--QRNSIIGDRYRWPI-PVPY 77

  Fly   125 EIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGDNSGCWSSVGRV-GGKQEVNLQ 188
            .:..:......|.:..|...|..:|||.|.....|.:|||:..| |||:|.||.: .|||:::| 
 Frog    78 FLEDSLEINAKALVLEAFERYRLKTCIDFKPWEGEPNYISVFKD-SGCYSYVGNLRQGKQQLSL- 140

  Fly   189 SPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFE--KAARTEAFGVPYD 251
            ...| .|..|..||.:|||||.|||:|.:||.||.|.::.:.....:||.  ...|:.:..||||
 Frog   141 GVNC-DRIATIQHEFLHALGFWHEQSRADRDDYVTIVWDRILPGREHNFNVYDDTRSNSLNVPYD 204

  Fly   252 YGSVMHYSKNAFSINGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDCGT 304
            |.|||||||.||....:|||:......:|.:|||..|||||::||||:|:|.:
 Frog   205 YTSVMHYSKTAFQNGSEPTIVTKIDAFSDVIGQRMDFSDYDLEKLNRLYNCSS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 82/190 (43%)
ZnMc_astacin_like 119..300 CDD:239807 77/183 (42%)
mep1bNP_001096352.1 ZnMc 26..255 CDD:412141 90/234 (38%)
MAM 265..428 CDD:395504
MATH 427..590 CDD:351761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.