DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc16 and APC7

DIOPT Version :9

Sequence 1:NP_477397.1 Gene:Cdc16 / 42753 FlyBaseID:FBgn0025781 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_572329.3 Gene:APC7 / 31594 FlyBaseID:FBgn0029879 Length:615 Species:Drosophila melanogaster


Alignment Length:699 Identity:132/699 - (18%)
Similarity:221/699 - (31%) Gaps:256/699 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EHIDLALYRQLVKQFIDMRRYS----------TALFWAEKVAVLGGLEPRDIYYQAQCMYLLGEY 69
            |.:::||:.. .|:..|.:.|.          |.|.....||.|      |:.||. .:|||...
  Fly     9 EKMEIALFAN-AKKLYDHKLYECVIPAADLLRTVLKNDRYVATL------DVEYQV-LLYLLNAN 65

  Fly    70 HRAAHTIQHHKLEKNSLPCFNLLLESLY--AAKEFTEAANVIQNVEVEVMTTSLINQPVDASSGC 132
            ::          |:|            |  |.:.|.|   :|....:.:...:.:...:::|   
  Fly    66 YK----------ERN------------YRAALRHFDE---IIHKRRLMMRHKNAVLVAIESS--- 102

  Fly   133 YLESNSVFGGEENHRNELLSSIYLMKGKVYEALDNRGMAMDFYVQ---ALHKSIYCFEALEALVQ 194
            |.|    ||..|..|.         ..:.|..:.|..||::..:|   .|...  ....:.|.:|
  Fly   103 YPE----FGDAEQRRR---------AAECYRQIGNTDMAIETLLQVPPTLRSP--RINLMLARLQ 152

  Fly   195 H-----------EMLMAWEEFELMHHLPLAQQSSEADAKFILKLYESRLKKYYELISARNAEEMS 248
            |           |.::|::  |::...|:|.|..||    :|:|             ..|..|::
  Fly   153 HHGSRHGTTKKSEAVLAYK--EVIRECPMALQVIEA----LLEL-------------GVNGNEIN 198

  Fly   249 PIVNPDILQFIKEFTARVQQSGSSDTQMPKVSAVKVPLTPSQFMSPAQKVLEDLKAPTFSLQTSL 313
            .:|                           :.|..|| ....::|...|.|    |..|:.:.| 
  Fly   199 SLV---------------------------MHAATVP-DHFDWLSKWIKAL----AQMFNFKHS- 230

  Fly   314 SKASSLIDASHRSMFDSSSRRRSRDHDTDTLIPIAECLDRVQRSTDLMAAEAEKCFYDCDYKQCL 378
                   |||...:.         .||..||    .|      :..||.|..:..:|:.||.|..
  Fly   231 -------DASQTFLM---------LHDNTTL----RC------NEHLMMALGKCLYYNGDYFQAE 269

  Fly   379 KILNELLKVDPFHNTALTIQ-IACLVENG---DFNRLFYVAHKLVDRYPDKAISWYA-VGCYYDM 438
            .|.:..|..:|.:..|:.:. :.|..|.|   |...:.|:..|:.......|..|:| ....||.
  Fly   270 DIFSSTLCANPDNVEAIGLMAVLCGQEGGCEQDSADMDYLFAKVSSEVKYTASHWFAHAQLLYDE 334

  Fly   439 IGKSDPARRYLSKATALDRLYGPAWLAYGHSFANENEHEQAMAAYFKATQLMRGCHLPLLYIGVE 503
             ||.:....::.|....:.....|.:..|........|.||:.| |:..|:              
  Fly   335 -GKFERGLNFVEKCLDSEPRNHEALILRGRLLIALERHTQAVCA-FRTAQM-------------- 383

  Fly   504 CGLTKNLELAEKFFLQAMNIAPLDVYVLHELGVIKYEYEFFDGAATIFQCTVDIVKQRAKSNNEE 568
                               :||             |.:|.:.|                      
  Fly   384 -------------------VAP-------------YRFEIYRG---------------------- 394

  Fly   569 ISSRWEPLFINLGHSLRKVHKYEEALYNFQYALLLKPQSPTTYTSIGFIHALLGNLDP-----AI 628
                       |.||.....:::||.....:.:.|...||.::|..|  ..|....||     |.
  Fly   395 -----------LFHSYLAQKRFKEANALCNWTIRLFQNSPRSFTMFG--RTLFLFPDPRMRRTAR 446

  Fly   629 EAFHKSLALNRDCIVTSTILKSCIEDLMDDSATIDEICSAALRDVAKNI 677
            :...|||.:|.  |.|..:      :|:.|...::....|.::.:.|::
  Fly   447 KFAEKSLKINH--IYTPAV------NLIADICQVEGPTKAIIKLLEKHV 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc16NP_477397.1 ANAPC3 31..112 CDD:289650 20/92 (22%)
TPR_11 425..489 CDD:290150 15/64 (23%)
TPR repeat 426..454 CDD:276809 8/28 (29%)
TPR repeat 462..488 CDD:276809 7/25 (28%)
TPR repeat 493..523 CDD:276809 0/29 (0%)
TPR repeat 528..552 CDD:276809 3/23 (13%)
TPR_11 576..638 CDD:290150 17/66 (26%)
TPR repeat 576..602 CDD:276809 5/25 (20%)
TPR repeat 607..637 CDD:276809 11/34 (32%)
APC7NP_572329.3 TPR repeat 251..277 CDD:276809 8/25 (32%)
TPR_11 321..386 CDD:290150 16/99 (16%)
TPR repeat 321..349 CDD:276809 8/28 (29%)
TPR repeat 354..384 CDD:276809 8/63 (13%)
TPR_11 356..418 CDD:290150 18/141 (13%)
TPR repeat 459..489 CDD:276809 5/35 (14%)
TPR repeat 493..521 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449300
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12558
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.