DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13827 and PEX11G

DIOPT Version :9

Sequence 1:NP_001247263.1 Gene:CG13827 / 42751 FlyBaseID:FBgn0039068 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_542393.1 Gene:PEX11G / 92960 HGNCID:20208 Length:241 Species:Homo sapiens


Alignment Length:211 Identity:63/211 - (29%)
Similarity:112/211 - (53%) Gaps:10/211 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVMKALCYSAKLVAGYHAKRNP---ELAKRYATASSRISGARATLRLIDDIPMIQYALEYGLGEN 85
            ::::.|.|..:||.|...::.|   |:..|....|:::|..|..|||.||:.|..|..:||||..
Human    19 RLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCRTILRLFDDLAMFVYTKQYGLGAQ 83

  Fly    86 EPDRVMQVLGVTANIVDLLYYPIEKVCWLAEHKIVDVKNADNWDNVNSIFWVLSVYLNLMRTMRN 150
            |.|..::.:.|..|:.|.||||.|.|.|.|:.:::.| ::..|..:::..|.||:.|.:.|::..
Human    84 EEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHV-DSSRWWTLSTTLWALSLLLGVARSLWM 147

  Fly   151 FSLNQEKLNR-----TNNINELDVKTL-TKHRLEMVSIVRISLDFVHAVSTLPKGYLWGGKLSTL 209
            ....:::|..     |:.:.....:.: .:.:.|.:|::....|..:||..||:|.||.|:....
Human   148 LLKLRQRLRSPTAPFTSPLPRGKRRAMEAQMQSEALSLLSNLADLANAVHWLPRGVLWAGRFPPW 212

  Fly   210 QVGAIGTLSAGLGIYQ 225
            .||.:||:|:.|.:||
Human   213 LVGLMGTISSILSMYQ 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13827NP_001247263.1 PEX11 24..226 CDD:283335 63/211 (30%)
PEX11GNP_542393.1 PEX11 4..229 CDD:310329 63/211 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160365
Domainoid 1 1.000 107 1.000 Domainoid score I6547
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12298
Inparanoid 1 1.050 107 1.000 Inparanoid score I4934
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50137
OrthoDB 1 1.010 - - D1522222at2759
OrthoFinder 1 1.000 - - FOG0006578
OrthoInspector 1 1.000 - - otm41454
orthoMCL 1 0.900 - - OOG6_105118
Panther 1 1.100 - - LDO PTHR20990
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5235
SonicParanoid 1 1.000 - - X6326
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.