DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13827 and PEX11

DIOPT Version :9

Sequence 1:NP_001247263.1 Gene:CG13827 / 42751 FlyBaseID:FBgn0039068 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_014494.1 Gene:PEX11 / 854018 SGDID:S000005507 Length:236 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:33/136 - (24%)
Similarity:59/136 - (43%) Gaps:17/136 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IKRIIRY------ERKVMKALCYSAKLVAGYHAKRNPELAKRYATASSRISGARATLRLIDDIPM 73
            :.|.:::      ..||::.|.|.|:.:    |.:|..|..|...|  :.:..|..||.:..:..
Yeast    12 VTRFVKFLDGSAGREKVLRLLQYLARFL----AVQNSSLLARQLQA--QFTTVRKFLRFLKPLNH 70

  Fly    74 IQYALEYGLGENEPDRVMQVLGVTANIVDLLYYPIEKVCWLAEHKIVDV-----KNADNWDNVNS 133
            :|.|.::...:...|.|::|..|..||....|..:::|..|...|::.|     |....|.|...
Yeast    71 LQAAAKFYDNKLASDNVVRVCNVLKNIFFAAYLSLDQVNLLRILKVIPVTVLTGKKIPRWSNWCW 135

  Fly   134 IFWVLS 139
            :|.:||
Yeast   136 LFGLLS 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13827NP_001247263.1 PEX11 24..226 CDD:283335 32/121 (26%)
PEX11NP_014494.1 PEX11 12..233 CDD:398979 33/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.