DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13827 and pex11g

DIOPT Version :9

Sequence 1:NP_001247263.1 Gene:CG13827 / 42751 FlyBaseID:FBgn0039068 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001072770.1 Gene:pex11g / 780227 XenbaseID:XB-GENE-5918391 Length:149 Species:Xenopus tropicalis


Alignment Length:126 Identity:41/126 - (32%)
Similarity:75/126 - (59%) Gaps:4/126 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVMKALCYSAKLVAGYHAKRNP---ELAKRYATASSRISGARATLRLIDDIPMIQYALEYGLGEN 85
            :|::.||||.:|:.|..:.::.   ...|.....:|::|..|..|||.||:.|:.|::.||||:.
 Frog    22 RVVRKLCYSCQLLGGVMSNKSEVDHNWGKSLLVVASQLSHCRTVLRLFDDLAMLAYSVNYGLGKK 86

  Fly    86 EPDRVMQVLGVTANIVDLLYYPIEKVCWLAEHKIVDVKNADNWDNVNSIFWVLSVYLNLMR 146
            |.|.:::.:.:.:||.|.||||.|.:.|.|:..::..| ::.|...::.||.||:.|.:::
 Frog    87 EKDPIIRWISIFSNISDQLYYPCEHIAWAADSGVISAK-SEIWWTASTAFWGLSLILGIVK 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13827NP_001247263.1 PEX11 24..226 CDD:283335 41/126 (33%)
pex11gNP_001072770.1 PEX11 7..>145 CDD:310329 41/123 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522222at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.