DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13827 and Pex11g

DIOPT Version :9

Sequence 1:NP_001247263.1 Gene:CG13827 / 42751 FlyBaseID:FBgn0039068 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001355305.1 Gene:Pex11g / 69129 MGIID:1920905 Length:247 Species:Mus musculus


Alignment Length:209 Identity:61/209 - (29%)
Similarity:106/209 - (50%) Gaps:10/209 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MKALCYSAKLVAGYHAKRNP---ELAKRYATASSRISGARATLRLIDDIPMIQYALEYGLGENEP 87
            ::.|.|..:|:.|...::.|   |:.:|....|::.:..|..|||.||:.|..|..:||||..|.
Mouse    27 IRTLGYCCQLIGGVLVEQCPNRSEVGRRLLVVSAQFNHCRTVLRLFDDLAMFVYTKQYGLGTKEE 91

  Fly    88 DRVMQVLGVTANIVDLLYYPIEKVCWLAEHKIVDVKNADNWDNVNSIFWVLSVYLNLMRTMRNFS 152
            |..::.|.|.:|:.|.||||.|.:.|.|:.|::.|.:| .|..:|:..|.||:.|..::.:....
Mouse    92 DIFIRWLSVLSNVTDQLYYPCEHIAWAADAKVLRVDSA-WWWTLNTALWTLSLLLGAVKALWTML 155

  Fly   153 LNQEKLNRTNNINELDVKTLTKHRL------EMVSIVRISLDFVHAVSTLPKGYLWGGKLSTLQV 211
            ..::||......:...:....:..:      |:::::....|..:||..||:|.||.|:.....|
Mouse   156 KLRQKLRSPTGTSASQLPRSKRRAMEARICSEVLTLLSNLADLANAVHWLPRGVLWAGRFPPWLV 220

  Fly   212 GAIGTLSAGLGIYQ 225
            |.:||:|:.|...|
Mouse   221 GLMGTISSILSTCQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13827NP_001247263.1 PEX11 24..226 CDD:283335 61/209 (29%)
Pex11gNP_001355305.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850719
Domainoid 1 1.000 107 1.000 Domainoid score I6553
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12298
Inparanoid 1 1.050 108 1.000 Inparanoid score I4896
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50137
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006578
OrthoInspector 1 1.000 - - otm43505
orthoMCL 1 0.900 - - OOG6_105118
Panther 1 1.100 - - LDO PTHR20990
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5235
SonicParanoid 1 1.000 - - X6326
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.