DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13827 and pex11b

DIOPT Version :9

Sequence 1:NP_001247263.1 Gene:CG13827 / 42751 FlyBaseID:FBgn0039068 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001039319.1 Gene:pex11b / 566742 ZFINID:ZDB-GENE-060825-289 Length:266 Species:Danio rerio


Alignment Length:237 Identity:49/237 - (20%)
Similarity:86/237 - (36%) Gaps:75/237 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERKVMKALCYSAKLVAGYHAKRNPELAKRYATASSRISGARATLRLIDDIPMIQYALE-----YG 81
            :.:|.:|..|:..|: ||..:|               .||||  .|::.|..::..:.     ..
Zfish    14 KERVFRAAQYACTLL-GYTLQR---------------GGARA--ELLNTIKQLEAHMSLTRKLMW 60

  Fly    82 LGENE------------PDRVMQVLGVTANIVDLLYYPIEKVCWLAEHKIVDVKNADNWDNVNSI 134
            ||.:.            .|.|:::....|::...:|:..:.|.|..:..::...:.:.|...:..
Zfish    61 LGNSAEALEAAKRTVHLSDCVLRLCITVAHLNRAMYFACDNVLWAGKTGLLPELDQNKWSQRSFR 125

  Fly   135 FWVLSVYLNLMRTMRNFSLNQEKLNR-------TNNINELDVKTLTKHRLEMVSIVRISLDFVHA 192
            :::.::.|||.|......|..|:.:|       |::.:.|   |.|....|..|||..|    ..
Zfish   126 YYLFALILNLTRDAYEIRLLMERESRGGSAKSFTSSPSPL---TPTPENGEFPSIVSPS----SG 183

  Fly   193 VSTLPKGYLWGGKLSTLQVGAIGTLSAGLGIYQIFAKRRLNK 234
            :|.||               .|..|||           ||||
Zfish   184 LSPLP---------------PIPVLSA-----------RLNK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13827NP_001247263.1 PEX11 24..226 CDD:283335 45/225 (20%)
pex11bNP_001039319.1 PEX11 1..258 CDD:283335 49/237 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.