DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13827 and pex11g

DIOPT Version :9

Sequence 1:NP_001247263.1 Gene:CG13827 / 42751 FlyBaseID:FBgn0039068 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001025343.1 Gene:pex11g / 563203 ZFINID:ZDB-GENE-050913-79 Length:240 Species:Danio rerio


Alignment Length:213 Identity:69/213 - (32%)
Similarity:121/213 - (56%) Gaps:12/213 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVMKALCYSAKLVAGYHAKRNPE--LAKRYATASSRISGARATLRLIDDIPMIQYALEYGLGENE 86
            ||::.|||.::||.|..:.::|:  |.|.....|:::|..|.||||.||:.|:.|:..||||.:|
Zfish    20 KVIRTLCYGSQLVGGVLSGKSPQSSLGKSLLLFSAQLSHCRTTLRLFDDLSMLAYSSGYGLGGSE 84

  Fly    87 PDRVMQVLGVTANIVDLLYYPIEKVCWLAEHKIVDVKNADNWDNVNSIFWVLSVYLNLMRTMRNF 151
            .|.:::.:.|.:|:.|.||||.|.:.|.|:.:::..| :|.|..:::..|..|:.|:::|::|:.
Zfish    85 EDALVRWMSVLSNVADQLYYPCEHIAWAADAELIKTK-SDRWWVLSTGLWGASLVLSILRSIRSI 148

  Fly   152 SLNQEKLNRTNNINELD-------VKTLTKH--RLEMVSIVRISLDFVHAVSTLPKGYLWGGKLS 207
            .:.:.|..:.:.....:       .|...|.  |.|:.||:..|.|..:||..:|.|:||.|:..
Zfish   149 LILKRKAQKCHRSGSAESREEVFSQKAALKRQIRAELFSILSSSADLCNAVHWMPPGFLWAGRFP 213

  Fly   208 TLQVGAIGTLSAGLGIYQ 225
            ...||.:||.|:.:|:.|
Zfish   214 PWLVGLMGTTSSLIGLLQ 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13827NP_001247263.1 PEX11 24..226 CDD:283335 69/213 (32%)
pex11gNP_001025343.1 PEX11 5..231 CDD:283335 68/211 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596727
Domainoid 1 1.000 124 1.000 Domainoid score I5496
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12298
Inparanoid 1 1.050 124 1.000 Inparanoid score I4693
OMA 1 1.010 - - QHG50137
OrthoDB 1 1.010 - - D1522222at2759
OrthoFinder 1 1.000 - - FOG0006578
OrthoInspector 1 1.000 - - otm25917
orthoMCL 1 0.900 - - OOG6_105118
Panther 1 1.100 - - LDO PTHR20990
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6326
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.