DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13827 and Pex11

DIOPT Version :9

Sequence 1:NP_001247263.1 Gene:CG13827 / 42751 FlyBaseID:FBgn0039068 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster


Alignment Length:249 Identity:57/249 - (22%)
Similarity:103/249 - (41%) Gaps:40/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LNTIAGKPLSRYQIKRIIRYERKVMKALCYSAKLVAGYHAKRNPELAKRYATASSRISGARATLR 66
            ||..||   .|.:|.|:|:|..:.|.....|        |..||.|...:.|....:|..|..||
  Fly     7 LNNQAG---GRDKIARLIQYASRAMWDSLES--------ANSNPALVDNFKTVEYILSTFRKLLR 60

  Fly    67 LIDDIPMIQYALEYGLGENEPDRVMQVLGVTANIVDLLYYPIEKVCWLAEHKIVDVKNADNWDNV 131
            ....:.:...||:   ..:.||..::|....:.:...|:...:...|||...:..| ||..|.|:
  Fly    61 FGKCVDVFYGALK---TIHHPDLNIRVTLTLSKLSQSLFLFADHFLWLARTGLTAV-NAKRWSNI 121

  Fly   132 NSIFWVLSVYLNLMR----TMRNFSLNQE-------------KLNRTNNINELDVKT---LTKHR 176
            .:.:|:.|:.:||.|    .:|...|::.             .:|...:...|.:::   :..|:
  Fly   122 ANKYWLFSIIMNLCRDFYEILRVLDLHRSGSKSGISRCRIPASINSPEDFKRLALQSYVLMQGHK 186

  Fly   177 LEMVSIVRISLDFVHAVSTLPKGYLWGGKLSTLQVGAIGTLSAGLGIYQIFAKR 230
            ..:|..|:.:.||...::.|  ||.   .|:...:|.:|.:|:..|::.:...|
  Fly   187 DIVVDTVKNACDFFIPLTAL--GYT---SLTPRTIGLLGAISSLAGLWALLEPR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13827NP_001247263.1 PEX11 24..226 CDD:283335 47/221 (21%)
Pex11NP_611071.1 PEX11 1..232 CDD:283335 56/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4186
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.