DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13827 and prx-11

DIOPT Version :9

Sequence 1:NP_001247263.1 Gene:CG13827 / 42751 FlyBaseID:FBgn0039068 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_493273.1 Gene:prx-11 / 353387 WormBaseID:WBGene00004196 Length:214 Species:Caenorhabditis elegans


Alignment Length:239 Identity:51/239 - (21%)
Similarity:105/239 - (43%) Gaps:56/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLNTIAGKPLSRYQIKRIIRYERKVMKALCYSAKLVAGYHAKRNPELAKRYATASSRISGARATL 65
            :|::.||:.              |.:::|.:..:|    .:..:|:.||.....:.::|.||...
 Worm    20 VLSSYAGRD--------------KAIRSLAFYLQL----KSTTSPDNAKEILGLAKQLSAARLVS 66

  Fly    66 R------LIDDIPMIQYALEYG-LGENEPDRVMQVLGVTANIVDLLYYPIEKVCWLAEHKIVDVK 123
            |      ::.....|..|.:.| :|    |.:..:.|.....:..:|..:|.:.||::.||:...
 Worm    67 RQFNHPGMLKSCRQIMQAFQTGRIG----DPLEFLTGAAVTGIYTVYGFVELLAWLSDAKILAFN 127

  Fly   124 NADNWDNVNSIFWVLSVYLN-----LMRTMRNFSLNQEKLNRTNNINELDVKTLTKHRLEMVSIV 183
            :|..:.      |.|.::|:     ::|.||                .:..|.:.|.:.:::::|
 Worm   128 SARLYK------WCLYLWLSELINGIVRQMR----------------VIYRKGIEKSQEDILTLV 170

  Fly   184 RISLDFVHAVSTLPKGYLWGGKLSTLQVGAIGTLSAGLGIYQIF 227
            .:|.||:..|::||...||.||||..|..:...|::.:|.|:::
 Worm   171 GLSSDFISGVNSLPHKILWAGKLSMRQSASFSLLASIIGFYKLW 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13827NP_001247263.1 PEX11 24..226 CDD:283335 48/213 (23%)
prx-11NP_493273.1 PEX11 14..214 CDD:283335 51/237 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167798
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I4118
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522222at2759
OrthoFinder 1 1.000 - - FOG0006578
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105118
Panther 1 1.100 - - LDO PTHR20990
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5235
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.