DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13827 and SPAC1F12.04c

DIOPT Version :9

Sequence 1:NP_001247263.1 Gene:CG13827 / 42751 FlyBaseID:FBgn0039068 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_594330.1 Gene:SPAC1F12.04c / 2542499 PomBaseID:SPAC1F12.04c Length:191 Species:Schizosaccharomyces pombe


Alignment Length:188 Identity:41/188 - (21%)
Similarity:74/188 - (39%) Gaps:49/188 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AKRNPELAKRYATASSRISGARATLRLIDDIPMIQYALEYGLGENEPDRVMQVLGVTANIVDLLY 105
            |:.:|..:|..|...|.::..|..|||    |.:...:.....::.|:..|      :|.:::.|
pombe    28 ARLDPASSKSTAQLVSMLNEFRCILRL----PGLYKLIVNFRKDSSPETYM------SNAINIGY 82

  Fly   106 YPIEKVCWLAEHKIVDVKN--ADN---WDNVNSIFWVLSVYLNLMRTMRNFSLNQEKLNRTNNIN 165
            |..|.:.:|...:|:.:..  .|.   |   :|.||:|...|.:.:.:|. ....||        
pombe    83 YVTEGLAFLGGKQIISISKPLEDKLWLW---SSRFWLLDTLLTIYQLLRE-KTEDEK-------- 135

  Fly   166 ELDVKTLTKHRLEMVSIVRISLDFVHAVSTLPKGYLW----GGKLSTLQVGAIGTLSA 219
                    :|:|::.|          .:::||....|    |..|...|:|.:|..||
pombe   136 --------EHQLDLAS----------NLASLPLCIHWSVENGAGLHKHQIGVLGLFSA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13827NP_001247263.1 PEX11 24..226 CDD:283335 41/188 (22%)
SPAC1F12.04cNP_594330.1 PEX11 16..182 CDD:283335 41/188 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105118
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.