DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13827 and Pex11a

DIOPT Version :9

Sequence 1:NP_001247263.1 Gene:CG13827 / 42751 FlyBaseID:FBgn0039068 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_035198.1 Gene:Pex11a / 18631 MGIID:1338788 Length:246 Species:Mus musculus


Alignment Length:197 Identity:40/197 - (20%)
Similarity:75/197 - (38%) Gaps:33/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KRYATASSRISGARATLRLIDDIPMIQYALEYGLGENEPDRVMQVLGVTANIVDLLYYPIEKVCW 113
            ||..|:   :|..|...||.:....|| |.|..:  ...|...::....||:..::||..:.|.|
Mouse    46 KRLETS---VSTGRKWFRLGNVFHAIQ-ATEQSI--QAADLAPRLCLTLANLNRVVYYICDTVLW 104

  Fly   114 LAEHKIVDVKNADNWDNVNSIFWVLSVYLNLMRTMRNFSL----------NQEKLNR-------T 161
            .....:....|.:.|....:..:...:.|:|:|.:....|          .:||.:|       .
Mouse   105 AKSVGLTSGVNREKWQRWAARHYYYFLLLSLVRDLYEILLQMGQVARDRAKREKSSRDPPKYSVA 169

  Fly   162 NNINE-------LDVKTLTKHRLEMVSIVRISLDFVHAVSTLPKGYLWGGKLSTLQVGAIGTLSA 219
            |...|       |..::|.:|...::..|:...|.:..::.|.   ::...|..:.:|.:.:..|
Mouse   170 NEETEWLQSFLLLLFQSLKRHPPLLLDTVKNFCDILIPLNQLG---IYKSNLGVVGLGGLISSLA 231

  Fly   220 GL 221
            ||
Mouse   232 GL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13827NP_001247263.1 PEX11 24..226 CDD:283335 40/197 (20%)
Pex11aNP_035198.1 PEX11 1..237 CDD:283335 40/197 (20%)
Required for homodimerization, interaction with PEX11G, and peroxisomal localization. /evidence=ECO:0000250|UniProtKB:O75192 218..238 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.