Sequence 1: | NP_001247263.1 | Gene: | CG13827 / 42751 | FlyBaseID: | FBgn0039068 | Length: | 234 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035198.1 | Gene: | Pex11a / 18631 | MGIID: | 1338788 | Length: | 246 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 40/197 - (20%) |
---|---|---|---|
Similarity: | 75/197 - (38%) | Gaps: | 33/197 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 KRYATASSRISGARATLRLIDDIPMIQYALEYGLGENEPDRVMQVLGVTANIVDLLYYPIEKVCW 113
Fly 114 LAEHKIVDVKNADNWDNVNSIFWVLSVYLNLMRTMRNFSL----------NQEKLNR-------T 161
Fly 162 NNINE-------LDVKTLTKHRLEMVSIVRISLDFVHAVSTLPKGYLWGGKLSTLQVGAIGTLSA 219
Fly 220 GL 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13827 | NP_001247263.1 | PEX11 | 24..226 | CDD:283335 | 40/197 (20%) |
Pex11a | NP_035198.1 | PEX11 | 1..237 | CDD:283335 | 40/197 (20%) |
Required for homodimerization, interaction with PEX11G, and peroxisomal localization. /evidence=ECO:0000250|UniProtKB:O75192 | 218..238 | 5/16 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4186 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |