| Sequence 1: | NP_651136.1 | Gene: | wda / 42750 | FlyBaseID: | FBgn0039067 | Length: | 743 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001290176.1 | Gene: | WDR61 / 80349 | HGNCID: | 30300 | Length: | 305 | Species: | Homo sapiens |
| Alignment Length: | 209 | Identity: | 54/209 - (25%) |
|---|---|---|---|
| Similarity: | 102/209 - (48%) | Gaps: | 10/209 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 491 FQLRGHTKGVTDVRFSAHYPLMYSVSKDATMRCWRAHNLHCAAIYRSHNYPIWCLDESPVGQYVV 555
Fly 556 TGSKDLSARLWSLE---KEHALIIYAGHTQD--VECVAFHPNGNYIATGSADHSVRLWCATSGKL 615
Fly 616 MRVFADCRQAVTQLAFSPDGKMLAAAGEETKVRIFDLAAGAQLAELKDHSASISSLSWSTHNRHL 680
Fly 681 ATACSDGTLRLWDI 694 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| wda | NP_651136.1 | TAF5_NTD2 | 104..273 | CDD:298747 | |
| WD40 | 324..>700 | CDD:225201 | 54/209 (26%) | ||
| WD40 | 491..700 | CDD:238121 | 54/209 (26%) | ||
| WD40 repeat | 501..537 | CDD:293791 | 10/35 (29%) | ||
| WD40 repeat | 542..578 | CDD:293791 | 12/38 (32%) | ||
| WD40 repeat | 585..619 | CDD:293791 | 10/33 (30%) | ||
| WD40 repeat | 626..662 | CDD:293791 | 9/35 (26%) | ||
| WDR61 | NP_001290176.1 | WD40 | 13..302 | CDD:238121 | 54/209 (26%) |
| WD 1 | 14..57 | ||||
| WD40 repeat | 19..62 | CDD:293791 | 1/3 (33%) | ||
| WD 2 | 62..101 | 14/38 (37%) | |||
| WD40 repeat | 68..105 | CDD:293791 | 10/36 (28%) | ||
| WD 3 | 104..143 | 11/38 (29%) | |||
| WD40 repeat | 110..146 | CDD:293791 | 12/40 (30%) | ||
| WD 4 | 146..187 | 11/40 (28%) | |||
| WD40 repeat | 152..188 | CDD:293791 | 10/35 (29%) | ||
| WD 5 | 188..227 | 9/38 (24%) | |||
| WD40 repeat | 193..229 | CDD:293791 | 9/35 (26%) | ||
| WD 6 | 230..269 | 6/32 (19%) | |||
| WD40 repeat | 236..271 | CDD:293791 | 5/26 (19%) | ||
| WD 7 | 272..305 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4155 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||