| Sequence 1: | NP_651136.1 | Gene: | wda / 42750 | FlyBaseID: | FBgn0039067 | Length: | 743 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001366327.1 | Gene: | Wdsub1 / 72137 | MGIID: | 1919387 | Length: | 475 | Species: | Mus musculus |
| Alignment Length: | 218 | Identity: | 60/218 - (27%) |
|---|---|---|---|
| Similarity: | 95/218 - (43%) | Gaps: | 23/218 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 493 LRGHTKGVTDVRFSAHYPLMYSVSKDATMRCWRAHNLHCAAI----YRSHNYPIWCLDESPVGQY 553
Fly 554 VVTGSKDLSARLWSLEKEHALIIY---AGHTQDVECVAFHPNGNYIATGSADHSVRLWCATSGKL 615
Fly 616 MRVFADCRQAVTQLAFSPDGKMLAAAGEETKVRIFDLAAGAQLAELKDHSASISSLSWST----- 675
Fly 676 ----HNRHLATACSDGTLRLWDI 694 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| wda | NP_651136.1 | TAF5_NTD2 | 104..273 | CDD:298747 | |
| WD40 | 324..>700 | CDD:225201 | 60/218 (28%) | ||
| WD40 | 491..700 | CDD:238121 | 60/218 (28%) | ||
| WD40 repeat | 501..537 | CDD:293791 | 9/39 (23%) | ||
| WD40 repeat | 542..578 | CDD:293791 | 11/38 (29%) | ||
| WD40 repeat | 585..619 | CDD:293791 | 15/33 (45%) | ||
| WD40 repeat | 626..662 | CDD:293791 | 8/35 (23%) | ||
| Wdsub1 | NP_001366327.1 | WD40 | 4..308 | CDD:238121 | 60/218 (28%) |
| WD 1 | 10..47 | 11/40 (28%) | |||
| WD40 repeat | 16..52 | CDD:293791 | 9/39 (23%) | ||
| WD 2 | 52..91 | 13/38 (34%) | |||
| WD40 repeat | 57..93 | CDD:293791 | 11/35 (31%) | ||
| WD 3 | 95..134 | 16/40 (40%) | |||
| WD40 repeat | 101..136 | CDD:293791 | 16/36 (44%) | ||
| WD 4 | 137..176 | 7/38 (18%) | |||
| WD40 repeat | 143..177 | CDD:293791 | 8/34 (24%) | ||
| WD 5 | 178..227 | 9/41 (22%) | |||
| WD40 repeat | 183..235 | CDD:293791 | 8/36 (22%) | ||
| WD 6 | 236..275 | ||||
| WD40 repeat | 241..264 | CDD:293791 | |||
| WD40 repeat | 283..307 | CDD:293791 | |||
| SAM_WDSUB1 | 327..398 | CDD:188904 | |||
| U-box | 403..475 | CDD:398320 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4155 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||