DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wda and CG1523

DIOPT Version :9

Sequence 1:NP_651136.1 Gene:wda / 42750 FlyBaseID:FBgn0039067 Length:743 Species:Drosophila melanogaster
Sequence 2:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster


Alignment Length:177 Identity:34/177 - (19%)
Similarity:70/177 - (39%) Gaps:43/177 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 ATMRCWRAHNLHCAAIYRSHNYPIWCLDESPVGQYVVTGSKDLSARLW-SLEKEHALIIYAGHTQ 582
            ::|..:.:::.:|..........|:.|:.:..|..||..::.....:: ::.::....:...||.
  Fly    28 SSMNMFNSYHANCWPTDAGRTGAIFNLEFNADGNVVVAATERKCVLVFDAITQKEIFKVPDAHTD 92

  Fly   583 DVECVAFHPNGNYIATGSADHSVRLWCATSGKLMRVFADCRQAVTQLAFSPDGKMLAAAGEETKV 647
            .|.|:.|. :....||||.|.:|.||            |.|..                  :.|:
  Fly    93 SVNCIKFF-DERLFATGSDDFTVALW------------DLRNM------------------KQKL 126

  Fly   648 RIFDLAAGAQLAELKDHSASISSLSWSTHNRHLATACSDGTLRLWDI 694
            |:           |..||..:.::.:|:.::.|.::..||::..|||
  Fly   127 RV-----------LHGHSNWVKNIEYSSKDKLLVSSGFDGSIFTWDI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdaNP_651136.1 TAF5_NTD2 104..273 CDD:298747
WD40 324..>700 CDD:225201 34/177 (19%)
WD40 491..700 CDD:238121 34/177 (19%)
WD40 repeat 501..537 CDD:293791 2/17 (12%)
WD40 repeat 542..578 CDD:293791 5/36 (14%)
WD40 repeat 585..619 CDD:293791 10/33 (30%)
WD40 repeat 626..662 CDD:293791 2/35 (6%)
CG1523NP_651635.2 WD40 43..235 CDD:295369 32/162 (20%)
WD40 <45..>218 CDD:225201 32/160 (20%)
WD40 repeat 51..87 CDD:293791 5/35 (14%)
WD40 repeat 95..129 CDD:293791 14/75 (19%)
WD40 repeat 136..174 CDD:293791 7/27 (26%)
WD40 repeat 181..210 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.