| Sequence 1: | NP_651136.1 | Gene: | wda / 42750 | FlyBaseID: | FBgn0039067 | Length: | 743 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_998111.2 | Gene: | wdr32 / 405882 | ZFINID: | ZDB-GENE-040426-2314 | Length: | 508 | Species: | Danio rerio |
| Alignment Length: | 260 | Identity: | 62/260 - (23%) |
|---|---|---|---|
| Similarity: | 90/260 - (34%) | Gaps: | 87/260 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 449 QEEETDEDSSDED----VKCSEEERRE----RNRARHCKYADNSYNEYGGFQLRGHTKGVTDVRF 505
Fly 506 SAHYPLMYSVSKDATMRCWRAHNLHCAAIYRSHNYPIW-CLDESPVGQYVVTGSKDLSARLWSLE 569
Fly 570 KEHALIIYAGHTQDVECVAFHPNGNYIATGSADHSVRLWCATSGKLMRVFADCRQAVTQLAFSPD 634
Fly 635 GKMLAAAGEETKVRIFDLAAGAQLAELKD-HSASISSLSWSTHNRHLATACSDGTLRLWDIKKLS 698
Fly 699 698 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| wda | NP_651136.1 | TAF5_NTD2 | 104..273 | CDD:298747 | |
| WD40 | 324..>700 | CDD:225201 | 62/260 (24%) | ||
| WD40 | 491..700 | CDD:238121 | 47/210 (22%) | ||
| WD40 repeat | 501..537 | CDD:293791 | 3/35 (9%) | ||
| WD40 repeat | 542..578 | CDD:293791 | 7/36 (19%) | ||
| WD40 repeat | 585..619 | CDD:293791 | 7/33 (21%) | ||
| WD40 repeat | 626..662 | CDD:293791 | 13/35 (37%) | ||
| wdr32 | NP_998111.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..75 | 15/53 (28%) | |
| WD 1 | 126..165 | 16/49 (33%) | |||
| WD40 | <129..279 | CDD:295369 | 28/87 (32%) | ||
| WD40 | <131..>294 | CDD:225201 | 26/74 (35%) | ||
| WD40 repeat | 132..167 | CDD:293791 | 12/34 (35%) | ||
| WD 2 | 169..207 | 12/36 (33%) | |||
| WD40 repeat | 174..210 | CDD:293791 | 11/31 (35%) | ||
| WD 3 | 211..250 | ||||
| WD40 repeat | 216..242 | CDD:293791 | |||
| WD 4 | 256..295 | ||||
| WD40 repeat | 261..288 | CDD:293791 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 307..343 | ||||
| WD 5 | 356..396 | ||||
| WD 6 | 419..457 | ||||
| WD 7 | 475..508 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4155 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||