Sequence 1: | NP_651136.1 | Gene: | wda / 42750 | FlyBaseID: | FBgn0039067 | Length: | 743 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_725799.1 | Gene: | CG30116 / 37126 | FlyBaseID: | FBgn0028496 | Length: | 1922 | Species: | Drosophila melanogaster |
Alignment Length: | 314 | Identity: | 68/314 - (21%) |
---|---|---|---|
Similarity: | 126/314 - (40%) | Gaps: | 58/314 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 431 YRRYPQKRCPWELNNCANQEEETDEDSSDEDVKCSEEERRERNRA----RHCKYADNSYNEYGGF 491
Fly 492 QLRGHTKGVTDVRFSAHYPLMYSVSKDATMRCWRAHNLHCAAI---YRSHNYP------------ 541
Fly 542 -----------IWCLDESPVGQ----------------YVVTGSKDLSARLWSLEKEHALIIYA- 578
Fly 579 GHTQDVECVAFHPNGNYIATGSADHSVRLWCATSGKLMRVFADCRQAVTQLAFSPDGKMLAAAG- 642
Fly 643 EETKVRIFDLAAGAQLAELKDHSASISSLSWSTHNRHLATACSDGTLRLWDIKK 696 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
wda | NP_651136.1 | TAF5_NTD2 | 104..273 | CDD:298747 | |
WD40 | 324..>700 | CDD:225201 | 68/314 (22%) | ||
WD40 | 491..700 | CDD:238121 | 56/250 (22%) | ||
WD40 repeat | 501..537 | CDD:293791 | 7/38 (18%) | ||
WD40 repeat | 542..578 | CDD:293791 | 8/51 (16%) | ||
WD40 repeat | 585..619 | CDD:293791 | 12/33 (36%) | ||
WD40 repeat | 626..662 | CDD:293791 | 9/36 (25%) | ||
CG30116 | NP_725799.1 | AAA_16 | 359..505 | CDD:289934 | |
WD40 repeat | 901..937 | CDD:293791 | |||
WD40 | 933..1282 | CDD:238121 | 22/100 (22%) | ||
WD40 repeat | 942..982 | CDD:293791 | |||
WD40 repeat | 988..1024 | CDD:293791 | |||
WD40 | 1022..1484 | CDD:225201 | 64/304 (21%) | ||
WD40 repeat | 1029..1064 | CDD:293791 | |||
WD40 repeat | 1071..1106 | CDD:293791 | |||
WD40 repeat | 1112..1147 | CDD:293791 | |||
WD40 repeat | 1216..1252 | CDD:293791 | 8/36 (22%) | ||
WD40 | 1248..1502 | CDD:238121 | 56/250 (22%) | ||
WD40 repeat | 1258..1294 | CDD:293791 | 7/38 (18%) | ||
WD40 repeat | 1299..1335 | CDD:293791 | 2/35 (6%) | ||
WD40 repeat | 1340..1374 | CDD:293791 | 7/35 (20%) | ||
WD40 repeat | 1379..1415 | CDD:293791 | 13/35 (37%) | ||
WD40 repeat | 1421..1458 | CDD:293791 | 9/36 (25%) | ||
WD40 repeat | 1464..1488 | CDD:293791 | 4/23 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4155 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |