DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wda and RGD1563991

DIOPT Version :9

Sequence 1:NP_651136.1 Gene:wda / 42750 FlyBaseID:FBgn0039067 Length:743 Species:Drosophila melanogaster
Sequence 2:XP_017457783.1 Gene:RGD1563991 / 367797 RGDID:1563991 Length:255 Species:Rattus norvegicus


Alignment Length:243 Identity:100/243 - (41%)
Similarity:147/243 - (60%) Gaps:9/243 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 LRGHTKGVTDVRFSAHYPLMYSVSKDATMRCWRAHNLHCAAIYRSHNYPIWCLDESPVGQYVVTG 557
            ||||...|...||.|....:.|.|:|.::|.|...:.....:|:.|.||:|.:|.||...|..:|
  Rat     4 LRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDVDISPYSLYFASG 68

  Fly   558 SKDLSARLWSLEKEHALIIYAGHTQDVECVAFHPNGNYIATGSADHSVRLWCATSGKLMRVFADC 622
            |.|.:|||||.::.:.|.|||||..||:||.||||.||:||||.|.:||||.|..|..:|:|...
  Rat    69 SHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGH 133

  Fly   623 RQAVTQLAFSPDGKMLAAAGEETKVRIFDLAAGAQLAELKDHSASISSLSWSTHNRHLATACSDG 687
            |..|..|:|||:||.||:|||:.::.::|||:|....||:.|:.||:||::|..:..:|:|..|.
  Rat   134 RGPVLSLSFSPNGKYLASAGEDQRLELWDLASGTLFKELRGHTDSITSLAFSPDSGLIASASMDN 198

  Fly   688 TLRLWDIKKLSPMSDNSSAGSSS------SATTNRVLTVN-SSCQRLV 728
            ::|:|||:  |...:..:.|||.      :...:.||:|. .:|..|:
  Rat   199 SVRVWDIR--STCCNTPADGSSGELVGVYTGQMSNVLSVQFMACNLLL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdaNP_651136.1 TAF5_NTD2 104..273 CDD:298747
WD40 324..>700 CDD:225201 92/206 (45%)
WD40 491..700 CDD:238121 92/206 (45%)
WD40 repeat 501..537 CDD:293791 9/35 (26%)
WD40 repeat 542..578 CDD:293791 15/35 (43%)
WD40 repeat 585..619 CDD:293791 20/33 (61%)
WD40 repeat 626..662 CDD:293791 17/35 (49%)
RGD1563991XP_017457783.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D230914at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.