| Sequence 1: | NP_651136.1 | Gene: | wda / 42750 | FlyBaseID: | FBgn0039067 | Length: | 743 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001014201.1 | Gene: | Wdsub1 / 362137 | RGDID: | 1359296 | Length: | 476 | Species: | Rattus norvegicus |
| Alignment Length: | 295 | Identity: | 72/295 - (24%) |
|---|---|---|---|
| Similarity: | 114/295 - (38%) | Gaps: | 73/295 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 480 YADNSYNEYGGFQLRGHTKGVTDVRFSAHYPLMYSVSKDATMRCWRAHNLHCAAIY-RSHNYPIW 543
Fly 544 CLDESPVGQYVVTGSKDLSARLWSLEKEHALIIY-AGHTQD---VECVAFHPNGNYIATGSADHS 604
Fly 605 VRLW-------------------CATSG----------KLMRVFADCRQ---------------- 624
Fly 625 --------------AVTQLAFSPDGKMLAAAGEETKVRIFDLAAGAQLAELKDHSASISSLSWST 675
Fly 676 HNRHLATACSDGTLRLWDIKKLSPMSDNSSAGSSS 710 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| wda | NP_651136.1 | TAF5_NTD2 | 104..273 | CDD:298747 | |
| WD40 | 324..>700 | CDD:225201 | 67/283 (24%) | ||
| WD40 | 491..700 | CDD:238121 | 65/272 (24%) | ||
| WD40 repeat | 501..537 | CDD:293791 | 10/36 (28%) | ||
| WD40 repeat | 542..578 | CDD:293791 | 10/36 (28%) | ||
| WD40 repeat | 585..619 | CDD:293791 | 13/62 (21%) | ||
| WD40 repeat | 626..662 | CDD:293791 | 13/35 (37%) | ||
| Wdsub1 | NP_001014201.1 | WD40 | 4..309 | CDD:238121 | 66/276 (24%) |
| WD 1 | 10..47 | 2/9 (22%) | |||
| WD40 repeat | 16..52 | CDD:293791 | 3/14 (21%) | ||
| WD 2 | 52..91 | 13/38 (34%) | |||
| WD40 repeat | 57..93 | CDD:293791 | 11/35 (31%) | ||
| WD 3 | 95..134 | 11/41 (27%) | |||
| WD40 repeat | 101..136 | CDD:293791 | 10/37 (27%) | ||
| WD 4 | 137..176 | 11/39 (28%) | |||
| WD40 repeat | 143..177 | CDD:293791 | 10/34 (29%) | ||
| WD 5 | 178..228 | 7/50 (14%) | |||
| WD40 repeat | 183..236 | CDD:293791 | 7/53 (13%) | ||
| WD 6 | 237..276 | 13/38 (34%) | |||
| WD40 repeat | 242..266 | CDD:293791 | 10/23 (43%) | ||
| WD 7 | 279..318 | 8/42 (19%) | |||
| WD40 repeat | 284..308 | CDD:293791 | 5/23 (22%) | ||
| SAM_WDSUB1 | 328..399 | CDD:188904 | |||
| U-box | 404..476 | CDD:398320 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4155 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||