DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wda and Dcaf10

DIOPT Version :9

Sequence 1:NP_651136.1 Gene:wda / 42750 FlyBaseID:FBgn0039067 Length:743 Species:Drosophila melanogaster
Sequence 2:NP_001101405.1 Gene:Dcaf10 / 313242 RGDID:1304730 Length:563 Species:Rattus norvegicus


Alignment Length:152 Identity:41/152 - (26%)
Similarity:66/152 - (43%) Gaps:39/152 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   588 AFHPNGNYIATGSADHSVRLWCATSGKLMRVFADCRQAVTQLAFSPDGKMLAAAGEETKVRIFDL 652
            :.||         || ||.|...|.|           ||..|.:||||.:|..|.|:|:|.:||.
  Rat   158 SIHP---------AD-SVYLSTRTHG-----------AVFNLEYSPDGSVLTVACEQTEVLLFDP 201

  Fly   653 AAGAQLAELKD-HSASISSLSWSTHNRHLATACSDGTLRLWDIKKLSPMSDNSSAGSSSSATTNR 716
            .:...:..|.: |...::::.: ..||..||...|.|:.|||::||:                .:
  Rat   202 ISSKHIKTLSEAHEDCVNNIRF-LDNRLFATCSDDTTIALWDLRKLN----------------TK 249

  Fly   717 VLTVNSSCQRLVDVFYGTSKTL 738
            |.|::.....:.::.|.|:..|
  Rat   250 VCTLHGHTSWVKNIEYDTNTRL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdaNP_651136.1 TAF5_NTD2 104..273 CDD:298747
WD40 324..>700 CDD:225201 36/112 (32%)
WD40 491..700 CDD:238121 36/112 (32%)
WD40 repeat 501..537 CDD:293791
WD40 repeat 542..578 CDD:293791
WD40 repeat 585..619 CDD:293791 9/30 (30%)
WD40 repeat 626..662 CDD:293791 13/35 (37%)
Dcaf10NP_001101405.1 WD40 <168..323 CDD:421866 34/132 (26%)
WD40 repeat 176..211 CDD:293791 12/34 (35%)
WD40 repeat 218..254 CDD:293791 13/52 (25%)
WD40 repeat 260..286 CDD:293791 3/12 (25%)
WD40 521..559 CDD:197651
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.