DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wda and rec14

DIOPT Version :9

Sequence 1:NP_651136.1 Gene:wda / 42750 FlyBaseID:FBgn0039067 Length:743 Species:Drosophila melanogaster
Sequence 2:NP_596145.1 Gene:rec14 / 2540221 PomBaseID:SPBC32F12.02 Length:302 Species:Schizosaccharomyces pombe


Alignment Length:327 Identity:71/327 - (21%)
Similarity:126/327 - (38%) Gaps:89/327 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 SAH-LDPSECHMLAGFDNSAVQLWQLNQSYCRGKSFYRRYPQKRCPWELNNCANQ-EEETD---- 454
            :|| .|....:::||      .||..:     |.|..::       |.:.:..:. .||.|    
pombe    13 NAHQADIYSLNVVAG------NLWSAS-----GDSKIKK-------WSIGDAEHSLVEEIDTPHK 59

  Fly   455 ------EDSSDEDVKCSEEERRERNRARHCKYADNSY------NEYGGFQLRGHTKGVTDVRFSA 507
                  ..|.||:|..|            |.:..:.|      ||:            .|:..:|
pombe    60 LGVHHLATSLDENVVVS------------CGFGQDVYVWNPETNEF------------RDLGNNA 100

  Fly   508 HYPLMYSVSKDATMRCWRAHNLHCAAIYRSHNYPIWCLDESPVGQYVVTGSKDLSARLWSLEKEH 572
            .:|          ..||.:                 |:  ||.||.:...|.|....:|....:.
pombe   101 QHP----------SECWSS-----------------CI--SPDGQTIAFTSVDGRIAVWDNPSDC 136

  Fly   573 ALIIYAGHTQDVECVAFHPNGNYIATGSADHSVRLWCATSGKLMRVFADCRQAVTQLAFSPDGKM 637
            .:.......:...|:.:.|||.:|.:|.....:.|....:|:|..|.:.....|..:||||...:
pombe   137 KISELDTKGKFGLCIDYSPNGRFIVSGHQTGQLFLISTETGRLFHVLSGHTSPVRSVAFSPGSTL 201

  Fly   638 LAAAGEETKVRIFDLAAGAQLAELKDHSASISSLSWSTHNRHLATACSDGTLRLWDIKKLSPMSD 702
            |||||:...:.|:|:.:|.|:.:|:.|:|.|.:::::.....|.:|..:|.:::|||..:..:|.
pombe   202 LAAAGDSKMITIYDVLSGDQVGQLRGHAAWIFAVAFNPVGDLLLSADVEGKIKIWDIDTMECIST 266

  Fly   703 NS 704
            .|
pombe   267 QS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdaNP_651136.1 TAF5_NTD2 104..273 CDD:298747
WD40 324..>700 CDD:225201 69/321 (21%)
WD40 491..700 CDD:238121 47/208 (23%)
WD40 repeat 501..537 CDD:293791 5/35 (14%)
WD40 repeat 542..578 CDD:293791 8/35 (23%)
WD40 repeat 585..619 CDD:293791 9/33 (27%)
WD40 repeat 626..662 CDD:293791 14/35 (40%)
rec14NP_596145.1 WD40 5..>296 CDD:225201 71/327 (22%)
WD40 15..297 CDD:238121 70/325 (22%)
WD40 repeat 63..98 CDD:293791 10/58 (17%)
WD40 repeat 103..142 CDD:293791 11/67 (16%)
WD40 repeat 149..184 CDD:293791 10/34 (29%)
WD40 repeat 190..226 CDD:293791 14/35 (40%)
WD40 repeat 232..267 CDD:293791 8/34 (24%)
WD40 repeat 274..296 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.