DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad60 and SUMO2

DIOPT Version :10

Sequence 1:NP_651134.1 Gene:Rad60 / 42748 FlyBaseID:FBgn0039065 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001154779.1 Gene:SUMO2 / 835609 AraportID:AT5G55160 Length:116 Species:Arabidopsis thaliana


Alignment Length:95 Identity:29/95 - (30%)
Similarity:41/95 - (43%) Gaps:27/95 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 RKPKK-----FQVKVQA----DKWKHPLVIPMKKTDNFKIIF-IKCAEELN------CDPR---- 390
            :||.:     .:||.||    ..|   |||   .||..::.| ||.:.:|.      ||.:    
plant     9 KKPDQGAHINLKVKGQAFFVVGTW---LVI---DTDGNEVFFRIKRSTQLKKLMNAYCDRQSVDF 67

  Fly   391 -TIKLFFDGDLLDPNDTPNNQDMEGNEVID 419
             :|...|||..|....||:..:||..:.||
plant    68 NSIAFLFDGRRLRAEQTPDELEMEDGDEID 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad60NP_651134.1 Ubl1_cv_Nsp3_N-like 254..315 CDD:475130
Ubl_SUMO_like 350..419 CDD:340462 25/89 (28%)
SUMO2NP_001154779.1 Ubl_Smt3_like 15..101 CDD:340533 27/89 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.