DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad60 and SUMO1

DIOPT Version :10

Sequence 1:NP_651134.1 Gene:Rad60 / 42748 FlyBaseID:FBgn0039065 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001358323.1 Gene:SUMO1 / 7341 HGNCID:12502 Length:146 Species:Homo sapiens


Alignment Length:65 Identity:12/65 - (18%)
Similarity:26/65 - (40%) Gaps:12/65 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 SEDEGEKEAPPVVEEENIFDNDNPTIEVALSWLGEIQIYKLRQHQKFKHLFKELASRNGIDENDI 294
            :||.|:|:....::.: :...|:..|.           :|::.....|.|.:....|.|:..|.:
Human    10 TEDLGDKKEGEYIKLK-VIGQDSSEIH-----------FKVKMTTHLKKLKESYCQRQGVPMNSL 62

  Fly   295  294
            Human    63  62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad60NP_651134.1 Ubl1_cv_Nsp3_N-like 254..315 CDD:475130 7/41 (17%)
Ubl_SUMO_like 350..419 CDD:340462
SUMO1NP_001358323.1 Ubl_SUMO1 21..141 CDD:340531 8/54 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.