powered by:
Protein Alignment Rad60 and SUMO1
DIOPT Version :9
Sequence 1: | NP_001262867.1 |
Gene: | Rad60 / 42748 |
FlyBaseID: | FBgn0039065 |
Length: | 424 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001358323.1 |
Gene: | SUMO1 / 7341 |
HGNCID: | 12502 |
Length: | 146 |
Species: | Homo sapiens |
Alignment Length: | 65 |
Identity: | 12/65 - (18%) |
Similarity: | 26/65 - (40%) |
Gaps: | 12/65 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 230 SEDEGEKEAPPVVEEENIFDNDNPTIEVALSWLGEIQIYKLRQHQKFKHLFKELASRNGIDENDI 294
:||.|:|:....::.: :...|:..|. :|::.....|.|.:....|.|:..|.:
Human 10 TEDLGDKKEGEYIKLK-VIGQDSSEIH-----------FKVKMTTHLKKLKESYCQRQGVPMNSL 62
Fly 295 294
Human 63 62
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Rad60 | NP_001262867.1 |
UBQ |
<392..422 |
CDD:294102 |
|
SUMO1 | NP_001358323.1 |
Ubl_SUMO1 |
21..141 |
CDD:340531 |
8/54 (15%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5227 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.