DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad60 and Sumo2

DIOPT Version :9

Sequence 1:NP_001262867.1 Gene:Rad60 / 42748 FlyBaseID:FBgn0039065 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_598278.1 Gene:Sumo2 / 690244 RGDID:621761 Length:95 Species:Rattus norvegicus


Alignment Length:95 Identity:22/95 - (23%)
Similarity:41/95 - (43%) Gaps:19/95 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 KSHNNNNVAAKIDYNPEALCRKPKKFQVKVQADKWKHPLVIPMKKTDNFKIIFIKCAEELNCDPR 390
            |:.||:::..|:.....::.    :|::|              :.|...|::...| |......|
  Rat    11 KTENNDHINLKVAGQDGSVV----QFKIK--------------RHTPLSKLMKAYC-ERQGLSMR 56

  Fly   391 TIKLFFDGDLLDPNDTPNNQDMEGNEVIDL 420
            .|:..|||..::..|||...:||..:.||:
  Rat    57 QIRFRFDGQPINETDTPAQLEMEDEDTIDV 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad60NP_001262867.1 UBQ <392..422 CDD:294102 11/29 (38%)
Sumo2NP_598278.1 Ubl_SUMO2_3_4 17..88 CDD:340532 19/89 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5227
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.