DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad60 and sumo1

DIOPT Version :10

Sequence 1:NP_651134.1 Gene:Rad60 / 42748 FlyBaseID:FBgn0039065 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_998324.1 Gene:sumo1 / 406438 ZFINID:ZDB-GENE-040426-2186 Length:100 Species:Danio rerio


Alignment Length:53 Identity:12/53 - (22%)
Similarity:25/53 - (47%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 MKKTDNFKIIFIKCAEELNCDPRTIKLFFDGDLLDPNDTPNNQDMEGNEVIDL 420
            :|.|.:.|.:....::.......:::..|:|..:..|.||....||..:||::
Zfish    37 VKMTTHLKKLKESYSQRQGVPVNSLRFLFEGQRITDNLTPKELGMEDEDVIEV 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad60NP_651134.1 Ubl1_cv_Nsp3_N-like 254..315 CDD:475130
Ubl_SUMO_like 350..419 CDD:340462 11/50 (22%)
sumo1NP_998324.1 Ubl_SUMO1 20..95 CDD:340531 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.