DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad60 and sumo1

DIOPT Version :9

Sequence 1:NP_001262867.1 Gene:Rad60 / 42748 FlyBaseID:FBgn0039065 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_998324.1 Gene:sumo1 / 406438 ZFINID:ZDB-GENE-040426-2186 Length:100 Species:Danio rerio


Alignment Length:53 Identity:12/53 - (22%)
Similarity:25/53 - (47%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 MKKTDNFKIIFIKCAEELNCDPRTIKLFFDGDLLDPNDTPNNQDMEGNEVIDL 420
            :|.|.:.|.:....::.......:::..|:|..:..|.||....||..:||::
Zfish    37 VKMTTHLKKLKESYSQRQGVPVNSLRFLFEGQRITDNLTPKELGMEDEDVIEV 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad60NP_001262867.1 UBQ <392..422 CDD:294102 9/29 (31%)
sumo1NP_998324.1 Sumo 10..96 CDD:176359 12/53 (23%)
UBQ 21..92 CDD:214563 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5227
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.