powered by:
Protein Alignment Rad60 and sumo1
DIOPT Version :9
Sequence 1: | NP_001262867.1 |
Gene: | Rad60 / 42748 |
FlyBaseID: | FBgn0039065 |
Length: | 424 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_998324.1 |
Gene: | sumo1 / 406438 |
ZFINID: | ZDB-GENE-040426-2186 |
Length: | 100 |
Species: | Danio rerio |
Alignment Length: | 53 |
Identity: | 12/53 - (22%) |
Similarity: | 25/53 - (47%) |
Gaps: | 0/53 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 368 MKKTDNFKIIFIKCAEELNCDPRTIKLFFDGDLLDPNDTPNNQDMEGNEVIDL 420
:|.|.:.|.:....::.......:::..|:|..:..|.||....||..:||::
Zfish 37 VKMTTHLKKLKESYSQRQGVPVNSLRFLFEGQRITDNLTPKELGMEDEDVIEV 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5227 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.