DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad60 and Sumo3

DIOPT Version :10

Sequence 1:NP_651134.1 Gene:Rad60 / 42748 FlyBaseID:FBgn0039065 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001288602.1 Gene:Sumo3 / 20610 MGIID:1336201 Length:113 Species:Mus musculus


Alignment Length:85 Identity:20/85 - (23%)
Similarity:36/85 - (42%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 KEAPPVVEEENIFDNDNPTIEVALSWLGEIQIYKLRQHQKFKHLFKELASRNGIDENDITVDMYY 300
            :|.|.|..|....:||:..::|| ...|.:..:|:::|.....|.|....|.|:....|......
Mouse     3 EEKPKVSPEGVKTENDHINLKVA-GQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDG 66

  Fly   301 NFVGPEDTPHSIGLKSFHTL 320
            ..:...|||..:.::...|:
Mouse    67 QPINETDTPAQLEMEDEDTI 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad60NP_651134.1 Ubl1_cv_Nsp3_N-like 254..315 CDD:475130 13/60 (22%)
Ubl_SUMO_like 350..419 CDD:340462
Sumo3NP_001288602.1 Ubl_SUMO2_3_4 19..90 CDD:340532 14/69 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.